(data stored in ACNUC7421 zone)

EMBL: CP001854.PE207

CP001854.PE207       Location/Qualifiers
FT   CDS_pept        complement(209655..210962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0207"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: pin:Ping_0445 colicin uptake-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48643"
FT                   /db_xref="GOA:D3F565"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3F565"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADB48643.1"
FT                   /translation="MASDTLAAARARGATLHAAIAQATLAATLGALDDVEGARRHRSSA
FT                   TALLARVPGAPPAERMEALLWLGVADWAALGDVRAARDRFARAAVIARDDEDAAIAVPA
FT                   LAIRAHASAVAGDLGSAATTAAAAVDAARRADAPDLLALALAADAWQLGARGETAAAVA
FT                   VGDELLALPDHGPHELTVLAAWSAAPALLDAGDAARCAELLAPVTSVERLAPLAPRTRA
FT                   LLLELRVRVAVALDDGDDARRQLAALQAQAFVQTPLGIASSCCAAAEVALHDDRPANAE
FT                   ALANDAADAARDAPSRLLEIRATVLAGHAQAALAAPDVAAERFAEAEAAARAAGALPLA
FT                   QEAARHRRALTGGADAWPSAADYGLTVRQLEIARLVASGSTNREVAELLGISDHTVNTH
FT                   LRAIFRRFGVSRRRELGAALQEAATRDAATPPRATG"
     gtggcgagcg acacgctcgc ggcggcgcgg gcgcgcggcg cgacgctgca cgccgcgatc        60
     gcgcaggcga cgctggcggc gacgctcggc gcgctcgacg acgtcgaggg cgcgcggcgc       120
     caccgcagca gcgcgacggc gctgctcgcg cgcgtgccgg gcgcgccgcc cgcggagcgg       180
     atggaggcgc tgctgtggct cggcgtcgcc gactgggccg cgctcggcga cgtgcgcgcc       240
     gcgcgcgatc gcttcgcgcg cgcggcggtg atcgcccgcg acgacgagga cgcggcgatc       300
     gcggtgccgg cgctggcgat ccgcgcgcac gcctccgccg tcgccggcga cctcggcagc       360
     gcggcgacga cggccgccgc cgcggtcgac gccgcccgtc gcgccgacgc gcccgacctg       420
     ctcgcgctcg cgctcgcggc cgacgcctgg caactgggcg cacgcggcga gacggccgcc       480
     gcggtcgcgg tcggcgacga gctgctggcg ctgcccgacc acgggcccca cgagctgacc       540
     gtgctcgccg cctggtcggc ggcgccggcg ctgctcgacg ccggcgacgc cgcccgctgc       600
     gccgagctgc tcgcgccggt gacgagcgtg gagcggctcg ccccgctcgc gccgcggacg       660
     cgggcgctgc tgctggagct gcgggtgcgc gtcgcggtcg cgctcgacga cggcgacgac       720
     gcgcgccggc agctcgccgc gttgcaggcg caggcgttcg tgcagacgcc gctcgggatc       780
     gcgagcagct gctgcgccgc cgccgaggtc gcgctccacg acgaccgccc cgcgaacgcc       840
     gaggcgctcg ccaacgacgc cgccgacgcc gcccgcgacg cgccgtcgcg gctgctggag       900
     atccgcgcga cggtgctcgc gggacacgcg caggcggcgc tcgcggcccc cgacgtggcg       960
     gctgagcggt tcgccgaggc ggaggccgca gcgcgcgctg ccggtgcgct gccgctcgcg      1020
     caggaggcgg cccggcaccg ccgcgcgctg acgggcggcg cggacgcgtg gccgtccgcc      1080
     gccgactacg ggctgaccgt ccgccagctg gagatcgccc ggctcgtcgc gtccggcagc      1140
     acgaaccgcg aggtcgccga gctgctcggg atcagcgacc acaccgtcaa cacgcacctg      1200
     cgcgcgatct tccgccgctt cggcgtcagc cgccggcgtg agctgggcgc agcgctgcag      1260
     gaggcggcga cgcgcgacgc cgcgacgccg ccgcgcgcga ccggctga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page