(data stored in ACNUC7421 zone)

EMBL: CP001854.PE208

CP001854.PE208       Location/Qualifiers
FT   CDS_pept        complement(211180..211761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0208"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bja:bll2216
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48644"
FT                   /db_xref="GOA:D3F566"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3F566"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48644.1"
FT                   /translation="MAEDEPVRPRADARRNRDAVVAAAIRLLAEDPDASMREIADASGV
FT                   SRMTVYRHFPSREDLLRAVFAHVHDDFAALGSWIVGAQAPAEETLRRFAREIVARSEHY
FT                   RFLTGYRALADEIFNDEQVIADADDVLVWLRAAHARGELRAELPPDWQFRMLRGLVTAA
FT                   CEEVLTGRATAAESGGLLGETLVAALVAPR"
     atggccgagg acgaacccgt cagaccgcgc gccgacgcgc gccgcaaccg cgacgccgtc        60
     gtcgccgcgg cgatccgcct gctggccgag gaccccgacg cgagcatgcg cgagatcgcc       120
     gacgcctccg gcgtctcgcg gatgaccgtc taccgccact tccccagccg cgaggacctg       180
     ctgcgggcgg tcttcgcgca cgtccacgac gacttcgccg cgctcggcag ctggatcgtc       240
     ggcgcgcagg cgccggcgga ggagacgctg cgccgcttcg cgcgcgagat cgtcgcgcgc       300
     agcgagcact accgcttcct gaccggctac cgcgcgctcg cggacgagat cttcaacgac       360
     gagcaggtga tcgcggacgc cgacgacgtg ctcgtctggc tgcgtgccgc gcacgcgcgc       420
     ggcgagctgc gcgccgagct gccgcccgac tggcagttcc gcatgctgcg cgggctcgtc       480
     accgccgcct gcgaggaggt cctcaccggc cgcgcgacgg cggcggagtc cggcggcctg       540
     ctcggcgaga cgctcgtcgc cgcgctcgtc gcaccgcgct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page