(data stored in ACNUC7421 zone)

EMBL: CP001854.PE209

CP001854.PE209       Location/Qualifiers
FT   CDS_pept        211844..213418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0209"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vap:Vapar_2891 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48645"
FT                   /db_xref="GOA:D3F567"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3F567"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADB48645.1"
FT                   /translation="MNTAAAAAARSRASGRDNPWLTLVAVALGVMMVGLDGTVVGVANP
FT                   TIAADLDASLAGLQWVTNGYLLALAVLLIVGGKLGDRFGRKKVFVIGIAGFALTSLLCA
FT                   LSTSTGMLVGARVLQGVAGALLMPNTLALLRAAFPPAELNRAVGIWGGASALAVASGPI
FT                   VGGLLVEHVSWESIFLLNLPLGLLAAVVTLRWVRESKDETHVGGFDVPGVALLSGGLFL
FT                   LIWGVIKAQDHGWGSAYVIGFGIAALVTLAGFVVREARTREPLLPLELFRNRSLSAGVV
FT                   LVVTGFFALFGILFFIGLYLQNVHGYSPIQTGVRLLPLTATFTISAPLGGLLTEKFGPR
FT                   VPLCLGMLILAGCFFGLTGLEVDTGYGGQWPFYLLIGLAMGFVIVASTEAIVGNAPVER
FT                   GGLAGGLQSTANQLGGVLGTAVLGSVIVSGVGSALAGNLADAGVPAAAAKAVEGQEELI
FT                   AQGVAPVTPGMPAGLAQAITDASFQSFMDGLHTAMWVSGVLALVSAAIALLVSRGHGAG
FT                   DGAAVHV"
     atgaacaccg ctgctgcagc ggcggcgcgc tctcgcgcgt ccggccgcga caacccctgg        60
     ctgacgcttg tcgccgtcgc gctcggcgtg atgatggtcg ggctcgacgg caccgtcgtc       120
     ggcgtcgcca acccgacgat cgccgccgac ctcgacgcct cgctcgcagg gctccagtgg       180
     gtcaccaacg gctacctgct cgcgctcgcc gtcctgctga tcgtcggcgg caagctcggc       240
     gaccgcttcg gccgcaagaa ggtcttcgtg atcggcatcg ccggcttcgc gctgacctcc       300
     ctgctgtgcg cgctgtcgac gtcgacgggg atgctcgtcg gcgcgcgcgt gctgcaaggc       360
     gtcgccggcg cgctgctgat gccgaacacg ctcgcgctgc tgcgcgccgc cttcccgccc       420
     gccgagctga accgcgcggt cgggatctgg ggcggcgcct ctgcgctcgc cgtcgcctcc       480
     ggcccgatcg tcggcggcct gctcgtcgag cacgtctcgt gggagtcgat cttcctgctc       540
     aacctcccgc tcggcctgct cgccgcggtc gtcacgctgc ggtgggtgag ggagtcgaag       600
     gacgagacgc acgtcggcgg cttcgacgtg cccggcgtcg cgctgctgtc cggcggtctc       660
     ttcctgctga tctggggcgt catcaaggcg caggaccacg gctggggctc ggcctacgtg       720
     atcggcttcg ggatcgcggc gctcgtcacg ctcgccggct tcgtcgtgcg cgaggcgcgc       780
     acgcgcgagc cgctgctgcc gctggagctg ttccgcaacc gctcgctgtc agccggcgtc       840
     gtgctcgtcg tgaccggctt cttcgcgctc ttcgggatcc tcttcttcat cgggctctac       900
     ctccagaacg tgcacggcta cagcccgatc cagaccggcg tgcggctgct gccgctgacc       960
     gcgacgttca cgatcagcgc gccgctcggc ggcctgctga cggagaagtt cggcccgcgc      1020
     gtgccgctct gcctcgggat gctgatcctc gccggatgct tcttcggcct cacggggctg      1080
     gaggtcgaca ccggctacgg cggccagtgg ccgttctacc tgctgatcgg gctcgcgatg      1140
     gggttcgtga tcgtggcctc gacggaggcg atcgttggca acgcgccagt cgagcgcggc      1200
     gggctggccg gcgggctgca gtcgacggcc aaccagctcg gcggcgtgct cggcacggcc      1260
     gtgctcggct cggtgatcgt ctccggcgtc ggctcggcgc tcgccggcaa cctcgccgac      1320
     gcgggcgtgc cggcggcagc ggcgaaggcg gtcgaggggc aggaggagct gatcgcgcag      1380
     ggcgtcgcgc cggtcacgcc cggcatgccg gccgggctcg cgcaggcgat caccgacgcg      1440
     tcgttccagt cgttcatgga cggcctccac acggcgatgt gggtcagcgg cgtgctggcg      1500
     ctcgtcagtg ccgcgatcgc gctgctcgtc agccgcggcc acggcgccgg cgacggcgcc      1560
     gcggtgcacg tctag                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page