(data stored in ACNUC7421 zone)

EMBL: CP001854.PE21

CP001854.PE21        Location/Qualifiers
FT   CDS_pept        complement(24931..25836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0021"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="TIGRFAM: flagellar hook-associated protein 3; PFAM:
FT                   flagellin domain protein; KEGG: gur:Gura_4098 flagellar
FT                   hook-associated protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48457"
FT                   /db_xref="GOA:D3EYQ4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ4"
FT                   /inference="protein motif:TFAM:TIGR02550"
FT                   /protein_id="ADB48457.1"
FT                   /translation="MAMRITAQMTARTTVRDLQGDLAQLSQLQRKMSSGKEITKPSDDP
FT                   YGTGRALGLHGEVAGLQQYQKNVDDGTAWLNASDTALGKIGDAINRVRELLIRVGTDSA
FT                   GQAARDAAASEVDQLIETIKQEANIQYAGRYVFAGTATDRQPYQLLGPDTFNGNTDRIQ
FT                   REIGPGVELDVNTDISGLFGNGQAAGDNRLLDTLRDIADNMRAGRGDDLRGTDIARLDA
FT                   NVDVLNGIRADVGARTNRMEIADGRLSSLEENSIELLSKVEDADTVKTLIEYTTQQAAY
FT                   NMALRAGSNVVQNSLMDFLR"
     atggccatgc gcatcaccgc acagatgacg gcccggacga ccgtccggga tctgcagggc        60
     gacctcgccc agctctcgca gctgcagcgc aagatgtcgt cgggcaagga gatcacgaag       120
     ccgtccgacg acccgtacgg gaccggccgg gcgctcgggc tgcacggcga ggtcgccggg       180
     ctgcagcagt accagaagaa cgtcgacgac gggaccgcct ggctgaacgc gagcgacacc       240
     gcgctcggca agatcggcga cgcgatcaac cgcgtccgcg agctgctgat ccgcgtcggc       300
     accgactccg ccggccaggc cgcgcgcgac gccgccgcct ccgaggtcga ccagctgatc       360
     gagacgatca agcaggaggc gaacatccag tacgccggcc gctacgtctt cgcgggcacc       420
     gcgaccgaca gacagcctta ccagctgctc ggcccggaca cgttcaacgg caacaccgac       480
     agaattcagc gcgagatcgg gccgggcgtc gagctcgacg tcaacaccga catctcgggc       540
     ctcttcggca acggccaggc cgcgggcgac aacagactgc tcgacaccct gcgcgacatc       600
     gccgacaaca tgcgcgcggg cagaggcgac gacctgcgcg gcaccgacat cgcccgcctc       660
     gacgcgaacg tcgacgtcct caacgggatc cgcgccgacg tcggcgcgcg cacgaaccgg       720
     atggagatcg ccgacggccg tctcagcagc ctcgaggaga actcgatcga gctgctgtcg       780
     aaggtcgagg acgccgacac ggtcaagacg ctgatcgagt acacgacgca gcaggccgcg       840
     tacaacatgg cgctgcgggc gggctcgaac gtcgtgcaga attccctgat ggacttcctc       900
     cgctag                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page