(data stored in ACNUC7421 zone)

EMBL: CP001854.PE210

CP001854.PE210       Location/Qualifiers
FT   CDS_pept        complement(213415..214797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0210"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: mxa:MXAN_5903
FT                   TrkA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48646"
FT                   /db_xref="GOA:D3F568"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F568"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADB48646.1"
FT                   /translation="MAGSEHALKRDDPYLAPMPMPHLVLGEGILAQGVEKALLAAGVPV
FT                   RRLRRPTDRELRRALKDDVAAVTVIDRDDISALRSALLVEYVRPGIRLVVTIFDRTVAD
FT                   QLISSIPNCNVVSMADASVGAIVGPCVDPQLVALHRTDDGDLIGVRDSGDEPPAVAPLP
FT                   YHPPSAAVRLTRRLRAQFRPPDRAARLLVWSVAGLLALVLLETALALSTHHEPFVHAVY
FT                   EATKAITTVGPSGFFEHGATWIQLYGIASMALGLVLTAVFTAALVNRLLSRRLTGIFGT
FT                   RTIPRVDHVVVVGLGQVGFRLCLELRALGIDVVAVEQDEHAPNVALARGLKLPVVIGRG
FT                   GDRYMLEGLSLSRARALAAVTSDELANISISVAALAVQPGLRTILRAGSNEITQETAAL
FT                   FPIGIAQDLDRVAAAAVAATAIGHELAHAFVHRGATYIETPGGTERFPPAPPAVAAAPD
FT                   RP"
     gtggcgggca gcgagcacgc gctgaagcgg gacgatccgt atcttgcgcc gatgccaatg        60
     ccccatctcg tcctcggtga ggggatcctc gcccagggcg tcgagaaggc gttgctcgcg       120
     gccggcgtcc cggtgcggcg gctgcgcagg ccgaccgacc gcgagctgcg ccgcgccctc       180
     aaagacgacg tcgcggcggt gacggtgatc gaccgcgacg acatcagcgc gctgcgcagc       240
     gcgctgctgg tcgagtacgt gcggccgggg atacggctcg tcgtgacgat cttcgaccgc       300
     accgtcgccg accagctgat cagctcgatc cccaactgca acgtcgtctc gatggcggac       360
     gcgtcggtcg gcgcgatcgt cgggccttgc gtcgacccgc agctcgtcgc gctccaccgc       420
     accgacgacg gcgacctgat cggcgtccgc gacagcggcg acgagccgcc cgcggtcgcg       480
     ccgctgccct accacccgcc gagcgcggcg gtgcggctga cgcggcggct gcgtgcgcag       540
     ttccgcccgc ccgaccgcgc ggcgcggctg ctcgtctggt cggtcgccgg cctgctcgcg       600
     ctcgtgctgt tggagaccgc actggcgctg agcacgcacc acgagccgtt cgtccacgcc       660
     gtatacgagg cgacgaaggc gatcacgacg gtcggcccga gcggtttctt cgagcacggc       720
     gcgacgtgga tccagctcta cgggatcgcg tcgatggcgc tcggcctggt gctgaccgcg       780
     gtcttcaccg ccgcgctcgt caaccgcctg ctgagccgcc gcctgacggg gatcttcggc       840
     acccgcacga tcccgcgcgt cgaccacgtc gtcgtcgtcg ggctcggcca ggtcggcttc       900
     cgcctctgcc tggagctgcg cgcgctcggg atcgacgtcg tcgccgtcga gcaggacgag       960
     cacgcaccga acgtcgcgct cgcgcgtggc ctcaaactgc cggtcgtgat cggccgcggc      1020
     ggcgaccgct acatgctcga aggcctctcg ctgagccgcg cccgcgcgct cgccgcggtc      1080
     accagcgacg agctggcgaa catctcgatc agcgtcgcgg cgctcgccgt ccagccgggg      1140
     ctgcggacga tcctgcgcgc cggctccaac gagatcacgc aggagaccgc cgcgctgttc      1200
     ccgatcggca tcgcgcagga cctcgaccgc gtcgcggccg ccgccgtcgc ggcgaccgcg      1260
     atcggccacg agctggcaca cgcgttcgtc caccgcggcg cgacgtacat cgagacgccg      1320
     ggcgggaccg agcgcttccc gcccgccccg cccgcggtcg cggccgcgcc ggaccgcccc      1380
     tag                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page