(data stored in ACNUC7421 zone)

EMBL: CP001854.PE211

CP001854.PE211       Location/Qualifiers
FT   CDS_pept        complement(214825..215250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_3076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48647"
FT                   /db_xref="GOA:D3F569"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3F569"
FT                   /inference="similar to AA sequence:KEGG:Gmet_3076"
FT                   /protein_id="ADB48647.1"
FT                   /translation="MTLYLDTSALVKLLVTEPGSEAVRAEAAAATELVSSHLTYVEIHS
FT                   ALARMHAGGRLTRRVHRRQLDAFVRMWEDVVVVPADAPVIDRAAALAERHVLRGFDALQ
FT                   LASAVELLGAGPARFASWDERLNAAAARERLELIPLG"
     ttgacgctct acctcgacac gagcgcgctc gtgaagctcc tcgtcaccga accggggagc        60
     gaggccgtgc gcgccgaggc tgctgcggcg acggagctgg tctccagcca cctcacgtac       120
     gtcgagatcc actcggcgct cgcgcggatg cacgccggcg gtcggctcac gagacgtgtc       180
     caccgcagac agctcgacgc gttcgtgcgg atgtgggagg acgtcgtcgt cgttccggcc       240
     gacgcgcccg tgatcgaccg cgctgccgca ctcgccgaac gtcacgtcct gcgcgggttc       300
     gacgcgctgc agctggcctc ggcggtcgag ctgctcggtg ccggcccggc gcggttcgcg       360
     tcgtgggacg agcgactcaa cgccgcggcc gctcgcgagc ggctggagct gatcccgctc       420
     ggctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page