(data stored in ACNUC7421 zone)

EMBL: CP001854.PE212

CP001854.PE212       Location/Qualifiers
FT   CDS_pept        complement(215247..215516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0212"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   gme:Gmet_3077 prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48648"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D3F570"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADB48648.1"
FT                   /translation="MREIGIRQLKNETSALIEQVEHGEVLTVTRRGRPVARVVPAGMSP
FT                   GIAQLVETGRVRWSGRKPALPPAVELRGDGPTAAEMVIDDRGDR"
     atgcgtgaga tcgggatccg gcagctgaag aacgagacga gcgcgctgat cgagcaggtc        60
     gagcacggtg aggtgctgac cgtgacccgg cgcggaagac ctgtcgcgcg cgtcgttccc       120
     gcgggcatgt cacccggcat cgcgcaactc gtcgagaccg gtcgcgtccg ttggagcgga       180
     cgcaagccgg cactcccgcc ggctgttgag ctgaggggcg acggccccac cgcggcggag       240
     atggtgatcg acgaccgcgg cgatcgttga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page