(data stored in ACNUC7421 zone)

EMBL: CP001854.PE213

CP001854.PE213       Location/Qualifiers
FT   CDS_pept        complement(215562..217172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48649"
FT                   /db_xref="UniProtKB/TrEMBL:D3F571"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48649.1"
FT                   /translation="MLLAALPACGGGADEPGGGQPRSGAATTAALPPATTPDRFAANFE
FT                   RVTGVRLVARPDGGGVRFDVPHVPDREPRLGIYAIRWSADSTARDGLLGAGPPDAQGRW
FT                   WKPDGAGAWTIAKPFGSHLVAEGPPSAARTPDARWLRLERAVAAAASGDLRTLPTAEQP
FT                   CRDRGLNALHGRTGACSVKGMPVTFVDALDELDTPLLQARVHGVETATVLEDPYGLLGS
FT                   RRADGRFVVVAFAVRNAGGGSIPSLHPQLHLGGRTFEQDPRAHALMPRSRSLPLEPGAT
FT                   FETWAAFDVPAALAAQASTGAFVLGTGADEHGLPSIDVEQGWIRLLAAPLSLPDPPDPA
FT                   QPPGGARSYRPPPTPFERGSGERIGATVRARYAASTFFPLPSTFAPGGIPIGSRAGICR
FT                   VPPLTTGVRAELRDAIRRQTPRGTLQPLDDDAILLADCGAAGRWALLTWTQVHRGRTVD
FT                   WIDELRDDGGGRWGGTARGVHPGCRMPLDAAAVWQIDVTACRRPPATPRAPAPSPAPRT
FT                   TPQPAPRDRERLPDGSSRA"
     gtgctgctgg ccgcgctccc ggcctgcggc ggcggagcgg acgagcccgg cgggggacag        60
     ccgcgcagcg gggccgctac caccgcggcg ctcccgcccg cgacgacgcc ggaccgcttc       120
     gccgccaact tcgagcgcgt caccggcgtg cggctcgtcg cgcgacccga cggcggcggc       180
     gtgcgcttcg acgtgccgca tgtccccgat cgcgagccgc gcctcggcat ctacgcgatc       240
     cgctggtcag ccgactccac cgcgcgcgac gggctgctcg gcgccggccc gcccgacgcc       300
     caggggcgct ggtggaagcc ggacggcgca ggcgcgtgga ccatcgccaa gcctttcggc       360
     tcgcacctcg tcgccgaggg gccgccgagc gcggcgcgta cgccggacgc gagatggctg       420
     cggctggagc gcgccgtcgc tgccgccgcc tccggcgacc tccgcaccct gcccacggcg       480
     gagcagccgt gccgcgaccg cgggctcaac gcgctccacg gccgaaccgg ggcatgcagc       540
     gtgaagggga tgccggtgac gttcgtcgac gcgctcgacg agctcgacac gccgctgctg       600
     caggcacgcg tgcacggcgt cgagacggcg accgtgctcg aggacccgta cgggctgctc       660
     ggcagccggc gcgccgacgg ccgcttcgtc gtggtggcgt tcgccgttcg caacgccggc       720
     ggcggctcga tcccctccct gcacccgcag ctccacctcg gcgggcggac gttcgagcag       780
     gacccgcgtg cgcacgcgct gatgccgcgg tcgcgctcgc tcccgctcga accgggcgcg       840
     acgttcgaga cctgggccgc gttcgacgtc cccgccgcgc tggccgccca ggcgagcacg       900
     ggcgcgttcg tcctggggac cggcgccgac gagcacggcc tgccgagcat cgacgtcgag       960
     cagggctgga tccgcctgct cgcggcgccg ctgtcgctgc ccgatccgcc cgatcctgcc      1020
     cagccgccgg ggggcgcgag aagctaccgg ccgccgccga ccccgttcga gcgcggcagc      1080
     ggcgaacgga tcggcgcgac cgtgcgggcg cgctacgcgg ccagcacgtt cttccccctg      1140
     ccgagcacgt tcgcgcccgg cgggatcccg atcggctcgc gcgccgggat ctgccgcgtg      1200
     ccgccgctga ccaccggggt ccgcgccgag ctgcgcgacg cgatccggcg ccagacgccg      1260
     cgcgggacgc tgcagccgct ggacgacgac gcgatcctgc tggccgactg cggcgccgcc      1320
     ggccgctggg cgctgctcac gtggacgcag gtccaccgcg ggcggacggt cgactggata      1380
     gacgagctgc gcgacgacgg cggcggaagg tggggcggca ccgcgcgcgg ggtccacccc      1440
     ggctgccgga tgccgctcga cgccgccgcg gtctggcaga tcgacgtgac cgcgtgcaga      1500
     cgaccgcccg ccacgccgag agcgccagcg ccgagcccgg cgcccagaac caccccccag      1560
     cccgcgccga gagaccgcga gcggctgccc gacggcagct cgcgggcgta g               1611
//

If you have problems or comments...

PBIL Back to PBIL home page