(data stored in ACNUC7421 zone)

EMBL: CP001854.PE214

CP001854.PE214       Location/Qualifiers
FT   CDS_pept        217281..217625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48650"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:D3F572"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48650.1"
FT                   /translation="MSGEHDDGVAVSYKALRRGTRVRGSDGAEVGKVHRVQDNVRENIF
FT                   DGIVVETRAGKRFVDAPEVAHIAERAVTLTIPAADVAALPVPRSRLAQRMEQARVVRRA
FT                   RRAARDIRDR"
     atgagcggtg agcacgacga cggcgtggcg gtctcgtaca aggcgttgag acgtggcacg        60
     cgcgtgcgcg ggagcgacgg cgccgaggtc ggcaaggtcc accgcgtgca ggacaacgtg       120
     cgcgagaaca tcttcgacgg gatcgtcgtc gagacgcgcg cgggcaagcg gttcgtggac       180
     gcgccggagg tcgcgcacat cgccgagcgc gccgtgacgc tgacgatccc cgcggcggac       240
     gtcgccgcgc tgccggtgcc caggtcgcgg ctcgcgcagc ggatggagca ggcgcgcgtc       300
     gtgcgccgcg cgagacgcgc cgcgcgcgac atccgcgacc gctga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page