(data stored in ACNUC7421 zone)

EMBL: CP001854.PE215

CP001854.PE215       Location/Qualifiers
FT   CDS_pept        217819..218193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48651"
FT                   /db_xref="InterPro:IPR024439"
FT                   /db_xref="UniProtKB/TrEMBL:D3F573"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48651.1"
FT                   /translation="MSRDQRHRARRREPSAFRCRNCGLDVPTDAPGTAHRNHCPSCLWS
FT                   RHLDDATPGDRAALCGSSMEPIAVAVRGDGEWVLVHRCAGCGELDLNRIAGDDNPLLLT
FT                   RLAVKPLAQPPFPLERLARL"
     ttgtcgcgcg accagcgaca ccgcgcccgg cgccgtgagc cgagcgcatt ccgatgccgc        60
     aactgcggtc tcgacgtgcc caccgacgca cccggcaccg cccatcgcaa ccactgtccg       120
     agctgcctct ggagccggca cctcgacgac gccacccccg gcgaccgcgc cgcgctgtgc       180
     ggctcgtcga tggagccgat cgccgtcgcc gtgcgcggcg acggcgagtg ggtgctggtc       240
     caccgctgcg ccggctgcgg cgagctggac ctgaaccgca tcgccggcga cgacaatccg       300
     ctgctgctca cgcggctcgc ggtcaagccg ctcgcgcagc cgccgtttcc gctcgaacgg       360
     ctcgcgcggc tgtga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page