(data stored in ACNUC7421 zone)

EMBL: CP001854.PE216

CP001854.PE216       Location/Qualifiers
FT   CDS_pept        218259..220772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0216"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48652"
FT                   /db_xref="UniProtKB/TrEMBL:D3F574"
FT                   /inference="protein motif:PFAM:PF01839"
FT                   /protein_id="ADB48652.1"
FT                   /translation="MPCAPAVPVRRRAGGLATVLVLAASLVPSGAAVAAPSPPTDEFAP
FT                   DPVQAEAVAGPAALALGDRNGDARPDAFIARWDGGVLVRPGTAAGPGTRPFDRSAEIVV
FT                   STPPGRLREIEAADWDGDGADDAVTLLDGEGLTVWTGNPLTGYLAIPDAHAVDTGDVDG
FT                   DGDLDALVTRIRRDEDLPLQVVSNGTPLPGIPVLERGAEIPACSEPTDARLVDVTDDGK
FT                   LDAVVVCPALGMVRVSPGLGGGSFGTAISSPAGASPFRLEAGDVVGDRNVDLAVTGSNV
FT                   VRIMRGFGDGSFGTPTSYAAAGRPRRVLLVDVDGDARLDLASATAETLDQDGVGYRLNR
FT                   GNGTFGTERRIAWAGAWDAQIADVTGDERPDLVAVANRAGSLAVWEGRAASDPVVELSG
FT                   LGVGVYEGAAGVALDPDARILGAAAANATTLTVTIASGRATGDVLSANPAAPFAPEWDP
FT                   ATAKLTISSALSQPADAWRAALRTVRFAHIASGLPGGATAGRRIVRAQLGTLPFASRSV
FT                   DVWLRPPEAGELRLTGVPVTGETLALDAGAWGGTPPVALRPTLERCPAGGGGCVALATD
FT                   LPYILRSADLGATLRVRGVGTGPDGTSATAYSPRTATIRRLAAPELLSGPGAVTADSTV
FT                   EVAFRGEEGATFACSVDAGAQAPCVSPLRVSGLADGSHTISVVQVMPSGARSAAAARVF
FT                   TVRRPVEPPPVTVTTTTPAPPPVTVTTPAPPPTTPVDPPRAAPRPALVVSSRATAAQLR
FT                   RGLLVRVQHVAKGARATATLQSGKRRVVATTLRATRAGTLQLRLRAASAAVAKLGRRNT
FT                   LGLAVTVAAPGARQVTLAARIAFRR"
     atgccatgcg cacccgccgt gcccgtccgc cgtcgcgcgg gcgggctcgc aacggttctc        60
     gtgctcgccg cgtcgctcgt cccgagcggc gcggcggtcg ccgcgccgtc gcctccgacc       120
     gacgaattcg cgccggatcc cgtgcaggcg gaggcggtcg cgggaccggc ggcgctcgcg       180
     ctcggcgacc gcaacggcga cgcgcggccg gacgcgttca tcgcgcggtg ggacgggggc       240
     gtgctggtgc ggcccgggac ggcggccggc cccggcacga gaccgttcga cagaagcgct       300
     gagatcgtcg tctcgacgcc gcccggcaga ctgcgcgaga tcgaggccgc cgactgggac       360
     ggagacggcg ccgacgacgc agtcaccctg ctcgacggcg agggcctgac cgtctggacc       420
     ggcaacccgc tcacgggcta cctcgcgatc ccggacgccc acgccgtcga caccggcgac       480
     gtcgacggcg acggtgatct tgacgcgctc gtcacgcgca tccggagaga cgaggacctt       540
     ccactgcagg tggtgtccaa cggcacaccg ctgcccggca tcccggtgct ggagagaggg       600
     gctgagatcc ccgcctgcag cgagccgacc gacgcacggc tcgtcgacgt gaccgacgac       660
     ggcaagctcg acgccgtcgt cgtctgcccg gcgctcggaa tggtgcgcgt gagtcccggc       720
     ctcggcgggg gcagcttcgg caccgcgatc tcgtcgcccg ccggggcgtc tccgttccgg       780
     ctcgaggcag gcgacgtcgt tggcgataga aacgtcgatc tcgcggtcac cggatcgaac       840
     gtcgtgcgga tcatgcgcgg cttcggcgac ggcagcttcg gcactcccac gagctacgcg       900
     gcagccggcc ggccgcgtcg ggtgctgctc gtcgacgtcg acggcgacgc ccgcctcgac       960
     ctcgccagcg cgacggccga gacgctggac caggacgggg tcggctatcg cctcaaccgc      1020
     ggcaacggca cgttcgggac cgagcgccgg atcgcgtggg cgggcgcgtg ggacgcgcag      1080
     atcgcggacg tgaccggcga cgagcgcccg gacctcgtcg cggtcgcgaa cagagccggc      1140
     agcctcgccg tctgggaggg acgcgcggcg tccgacccgg tcgtcgagct gagcggactc      1200
     ggggtcggcg tctacgaggg cgccgcgggc gtcgcgctcg atcccgacgc gcggatcctc      1260
     ggcgccgcgg cggcgaacgc gacaacgctg acggtcacga tcgccagcgg tcgcgccacc      1320
     ggcgacgtgc tgagcgcgaa cccggcggcg ccgttcgcgc ccgagtggga cccggcgacc      1380
     gccaagctga cgatctcctc ggcgctgtcg cagccggcgg acgcctggag agccgcgctg      1440
     cggacggtgc gcttcgccca catcgcctcc ggcttgcccg gaggcgcgac cgcgggacgc      1500
     cggatcgtgc gcgcgcagct cggcacgctg ccgttcgcgt cacgctcggt cgacgtctgg      1560
     ctgcggccgc cggaggccgg cgagctgcgg ctgacgggcg ttcccgtgac cggcgagacg      1620
     ctcgcactcg acgcgggagc gtggggaggc acgccgccgg tcgcgctcag accgacgctc      1680
     gaacgctgtc ccgcgggcgg tggcggatgc gtcgcgctcg cgaccgatct gccgtacatc      1740
     ctgcgcagcg ccgacctcgg cgcgaccctg cgcgtgcgcg gggtcggcac ggggccggac      1800
     gggacgtcgg cgaccgccta ctcgccgcgc acggcgacga tccgcagact ggccgcgccg      1860
     gagctgctgt ccgggccggg cgccgtgacc gccgactcca ccgtcgaggt ggcgttccgc      1920
     ggtgaggagg gcgcgacgtt cgcgtgcagc gtcgacgcgg gcgcgcaggc gccgtgcgtc      1980
     tcgccgctgc gcgtcagcgg gctggccgac ggctcccaca cgatcagcgt cgtgcaggtg      2040
     atgccgtcag gcgcccgctc ggccgcagcg gcgcgcgtct tcaccgtccg ccggccggtc      2100
     gagccgccgc ccgtgaccgt cacgaccacg acgcccgcac cgccccccgt gacggtcacg      2160
     acgccggcgc cgcccccgac gacgccggtc gatccgccca gagctgcgcc gagaccggcg      2220
     ctcgtcgtgt cgagcagagc gactgcggct cagctgcgcc gcggcctgct cgtgcgcgtc      2280
     cagcacgtcg cgaagggcgc gagagcgacc gcgacgctgc agagcgggaa acggcgcgtc      2340
     gtcgcgacga cgctgcgcgc cacgcgcgcg ggcacgctgc agctgagact gcgagcggcg      2400
     agcgccgccg tcgccaagct cgggcgcaga aacacgctcg gtctcgcggt gaccgtcgcc      2460
     gctcccggcg ccagacaggt gacgctggcc gcgcggatcg ccttccgccg ctga            2514
//

If you have problems or comments...

PBIL Back to PBIL home page