(data stored in ACNUC7421 zone)

EMBL: CP001854.PE217

CP001854.PE217       Location/Qualifiers
FT   CDS_pept        complement(220781..221569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0217"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   Polyketide cyclase/dehydrase; KEGG: scl:sce2341
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48653"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D3F575"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADB48653.1"
FT                   /translation="MSDDDRREIRIEVEVDATPEEAWEAIATGPGITAWYVPATVDERV
FT                   GGEIALDFGGEMRESTRIVVWDPPHRLAYDIPSERGRGLAFEFVIEAQAGGTSLVRLVN
FT                   SGFGTSADWDAEYDGMDSGWRLFLANLVLYLRHFPGQHAASLIVNGVAAGPRPAAWERL
FT                   VQAAGLPAAPAVGDRVETGGDSTPALAGVVERIADEMLTLRTDTPAPGHVFFAAEGGGI
FT                   QIFTSFYAYFFGDDADAVVASETPGWQAWMAAHFPPPADD"
     atgagcgacg acgacagacg cgagatccgc atcgaggtcg aggtcgacgc cacgcccgag        60
     gaggcgtggg aggcgatcgc gacagggccg ggaatcacgg cctggtatgt gccggcgacc       120
     gtcgacgagc gcgtcggcgg cgagatcgcg ctggacttcg gcggcgagat gcgcgagtcg       180
     acccgcatcg tcgtgtggga cccgccccac cggctcgcgt acgacatacc gagcgagcgc       240
     ggcagaggcc tcgcgttcga gttcgtgatc gaggcgcagg cgggcggcac ctcgctcgtg       300
     cggctcgtca acagcggctt cggcacgagc gccgactggg acgccgagta cgacgggatg       360
     gacagcggct ggcggctgtt cctcgcgaac ctcgtgctgt acctgcggca cttcccgggg       420
     cagcacgccg cgtcgctgat cgtcaacggc gtcgcggccg gcccgcgccc cgcggcgtgg       480
     gaacggctcg tgcaggcggc cggactgccc gccgcgcccg ccgtcggcga tcgcgtcgag       540
     acgggcggcg acagcacgcc ggcgctcgcc ggggtcgtcg agcgcatcgc cgacgagatg       600
     ctgacgctgc gcaccgacac acccgcgccc ggccacgtct tcttcgccgc cgagggcggc       660
     gggatccaga tcttcacgag cttctacgcc tacttcttcg gcgacgacgc ggacgccgtc       720
     gtcgcgagcg agacgccggg ctggcaggcg tggatggccg cgcacttccc gcccccggcc       780
     gacgactga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page