(data stored in ACNUC7421 zone)

EMBL: CP001854.PE218

CP001854.PE218       Location/Qualifiers
FT   CDS_pept        complement(221657..222025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48654"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D3F576"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48654.1"
FT                   /translation="MLRLMDDLGAPTSYLALATGVPVHDADGKRIGTVEHVLADDAEDV
FT                   FDGIVVDTRSGPGGLRFADADQVERLYERGVVLKVGEDELHDPEPGAAVIDVDPADLDE
FT                   SPLTARLRRAWDWISGRY"
     atgctgcggc tgatggacga tctcggcgcg cccacctcgt atctcgcgct tgcgaccggc        60
     gtccccgtcc acgacgcgga cggcaagcga atcggcacgg tcgaacacgt gctggccgac       120
     gacgccgagg acgtcttcga cgggatcgtc gtcgacacgc gcagcgggcc gggcggcctc       180
     cgcttcgccg acgccgacca ggtcgaacgg ctgtacgagc gcggcgtcgt gctgaaggtg       240
     ggcgaggacg agctgcacga cccggagcca ggcgccgcgg tgatcgacgt cgatcccgcc       300
     gacctcgacg agtcgccgct gacggctcgc ctgcggcgcg catgggactg gatcagcggg       360
     cgctactga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page