(data stored in ACNUC7421 zone)

EMBL: CP001854.PE219

CP001854.PE219       Location/Qualifiers
FT   CDS_pept        complement(222057..223211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0219"
FT                   /product="peptidase dimerization domain protein"
FT                   /note="PFAM: peptidase dimerisation domain protein;
FT                   peptidase M20; KEGG: rso:RS03691 glutamate
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48655"
FT                   /db_xref="GOA:D3F577"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D3F577"
FT                   /inference="protein motif:PFAM:PF07687"
FT                   /protein_id="ADB48655.1"
FT                   /translation="MPPVDAWVQQAAAGIAERAERDLEALVAVSSPSGDVHGAEDCVAV
FT                   VRALVPPAAAIERIPCSSPGHADDVVVRIAGSGSGRLLLLGHLDTVVPHERHEPLRRDG
FT                   ERLVGSGTVDMKGGDVLALGLLRALAEQPQRFAEVALLLVVDEEWRTGPMVHVDRFAGW
FT                   DGCLCFEAGELAPDGSDAVIVRRKAAGTLRVRARGVAAHAGSAPHKGRNALLALAAAAQ
FT                   AVAAAHAPDGHDRLTSVPTMLHSGDAFNVVPDAGELACDLRSDRTAAFEEVRALVPREL
FT                   AGVELDAELTRVWPAMDARAATAPLLASAAELLGRPLVAAGRGGASDASHVAPAIPFTV
FT                   DGLGPRGGRAHAPGEFVLAAALHSRAEVAVALAAAVLDAAGATV"
     gtgccccccg tggacgcatg ggtccagcag gccgcagcgg ggatcgccga gcgcgcggag        60
     cgcgacctcg aagcgctcgt cgccgtctcc tccccctccg gcgacgtgca cggcgccgag       120
     gactgcgtcg cggtcgtgcg ggcgctcgtg ccgcctgcgg ctgcgatcga gcggatcccc       180
     tgctcctcgc ccggccatgc cgacgacgtc gtcgtgcgga tcgccggcag cggcagcgga       240
     cggctgctgc tgctcggcca tctcgacacg gtcgtcccgc acgagcgcca cgagccgctg       300
     cggcgcgacg gcgagcggct ggtcggctcc ggcacggtcg acatgaaggg cggcgacgtg       360
     ctcgcgctcg ggctgctgcg tgcgctcgcc gagcagccgc agcggttcgc cgaggtcgcg       420
     ctgctgctcg tcgtcgacga ggaatggcgc accgggccga tggtgcacgt cgaccgcttc       480
     gccggctggg acggctgcct ctgcttcgag gccggcgagc tggcgccgga cggcagcgac       540
     gccgtgatcg tcagacgcaa ggcggccgga acgctgcgcg tgcgggcgcg cggcgtcgcc       600
     gcgcatgcgg gctcggcgcc gcacaagggc cgcaacgcgc tgctcgcgct cgccgccgcg       660
     gcgcaggccg tcgccgccgc gcacgcgccc gacgggcacg accgcctcac ctccgtcccg       720
     acgatgctgc acagtggcga cgcgttcaac gtcgtgcccg acgcgggcga gctggcgtgc       780
     gacctgcgct cggaccgcac cgccgcgttc gaggaggtgc gcgcgctggt cccgcgcgag       840
     ctggcgggcg tcgagctgga cgccgagctg acgcgcgtgt ggccggcgat ggacgcgcgc       900
     gcggcgaccg cgccgctgct cgcctccgcg gcggagctgc tcggccggcc gctggtcgcc       960
     gccggccgcg gcggcgccag cgacgcgagc cacgtcgcgc ccgcgatccc cttcaccgtc      1020
     gacggtctcg gaccgcgcgg cgggcgtgcg cacgcgccgg gcgagttcgt gctcgcggcg      1080
     gcgctgcact cgcgcgccga ggtcgcggtc gcgctcgcgg cggcggtgct cgacgcggcc      1140
     ggcgccaccg tctga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page