(data stored in ACNUC7421 zone)

EMBL: CP001854.PE22

CP001854.PE22        Location/Qualifiers
FT   CDS_pept        complement(25839..27170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0022"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein; KEGG: ppd:Ppro_3455
FT                   flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48458"
FT                   /db_xref="GOA:D3EYR3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYR3"
FT                   /inference="protein motif:TFAM:TIGR02492"
FT                   /protein_id="ADB48458.1"
FT                   /translation="MPISSFMGLQTSLRGLIAHQQALNTTGHNVANANTPGFSRQEAIF
FT                   GAMSALRLPTNSGTTGLGAQLGTGVDVLGIRRIRDSFLDLQFRGTNMQLGDASARTQSL
FT                   EQVELSFGEPSSSGINALLGRFWDAWSALASAPEEGSAARTAVIEMANTLAGAFQTVHA
FT                   QLTRVAAQAQGKYDEITGPAGDVDIWAQELAQLNRTIAHAVTVGQVPNDLMDRRDLLID
FT                   RLSELSQVSVTDVGDGSVRVEFGGVTLVDPAAAGGYTWPQTLTSRDGKLGALRDLASPT
FT                   GPALSFRDRLDTVAADLVARVNALHRAPGGVDFFAPAGTTADRISVVATAATVVAGSTA
FT                   DRGRNDVANAIAQLRNGSINRTYSALVSEVGSVVRRASSAEAIQQSLVDNIDDRRQSVQ
FT                   GVSPDEEMTNMIRFQRGYQASARTMSTLDEMLDTLINRTGRVGL"
     atgccgatct cctccttcat gggcctgcag acctcgctgc gcggcctgat cgcccaccag        60
     caggccctca acacgacggg ccacaacgtc gccaacgcga acacgcccgg gttctcccgc       120
     caagaggcga tcttcggcgc gatgagcgcg ctccgcctcc cgaccaactc cggcaccacc       180
     ggacttggcg cccagctcgg caccggcgtc gacgtgctcg ggatccgccg catccgcgac       240
     agcttcctcg acctccagtt ccgcggcacg aacatgcagc tcggcgacgc ctccgcgcgg       300
     acgcagtcgc tcgagcaggt ggagctgtcg ttcggcgagc ccagctccag cggcatcaac       360
     gcgctgctcg gcagattctg ggacgcctgg agcgcgctcg ccagcgcgcc cgaggagggc       420
     tccgcggcgc gcacggccgt gatcgagatg gcgaacaccc tcgcgggcgc cttccagacc       480
     gtccacgcgc agctgacgag agtcgcggcg caggcgcagg gcaagtacga cgagatcacc       540
     ggcccggccg gcgacgtcga catctgggcg caggagctcg cgcagctgaa cagaacgatc       600
     gcgcacgcgg tcacggtcgg ccaggtgccg aacgacctga tggaccgccg cgacctcctg       660
     atcgacagac tctccgagct gtcgcaggtg tcggtcaccg acgtcggcga cggctcggtc       720
     agagtcgagt tcggcggcgt cacgctcgtc gacccggctg ccgccggcgg ctacacgtgg       780
     ccgcagacgc tgacctccag agacggcaag ctcggcgcgc tgagagacct cgcctcgccg       840
     accggccccg cgctgagctt ccgcgacaga ctcgacaccg tcgccgccga cctcgtcgcg       900
     agagtcaacg cgctccacag agcgcccggc ggcgtcgact tcttcgcccc cgccggcacg       960
     accgcagaca gaatcagcgt cgtcgcgacg gccgcgaccg tcgtcgccgg cagcaccgcc      1020
     gacagaggca gaaacgacgt cgcgaacgcg atcgcgcagc tgcgcaacgg ctcgatcaac      1080
     agaacgtact cggcgctcgt ctccgaggtc ggcagcgtcg tgcgcagagc ctccagcgcc      1140
     gaggcgatcc agcagtcgct cgtcgacaac atcgacgacc gccgccagag cgtgcagggc      1200
     gtctcccccg acgaggagat gacgaacatg atccgcttcc agcgcggcta ccaggcgtcg      1260
     gcgcggacga tgtcgacgct cgacgagatg ctcgacacgc tgatcaaccg gaccggacgg      1320
     gtgggactct ag                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page