(data stored in ACNUC7421 zone)

EMBL: CP001854.PE220

CP001854.PE220       Location/Qualifiers
FT   CDS_pept        223227..223991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48656"
FT                   /db_xref="GOA:D3F578"
FT                   /db_xref="UniProtKB/TrEMBL:D3F578"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48656.1"
FT                   /translation="MTAVIISLDLVQTNAEPGRESAFLVLLAFLCSFGFIRTSARLTRS
FT                   VSWWPGGVQTEGGVHLHHLVWGIVLLLVSGFAAFATDLVAPWWQITSIAFGIGAGFTLD
FT                   EFALWVRLQDVYWSDEGRASLDAVVLATVFAGLVVFGVNPYGLDEAGSIVGTAAWFALT
FT                   LAFAGIAFFKGRMVLGMVAIFVPFVAGAWAAVRLAKPTSPWARRYDADKLARARARYGP
FT                   DTRGARFGRRFLDAIGGAPSEPDPPGPPARPG"
     atgaccgccg tcatcatctc gctcgacctc gtccagacga acgccgagcc cggccgcgaa        60
     tcggccttcc tcgtgctgct cgcgttcctc tgctcgttcg gcttcatccg caccagcgcc       120
     cggctgacgc gcagcgtctc gtggtggccc ggcggcgtgc agacggaggg cggcgtccac       180
     ctccaccacc tcgtgtgggg gatcgtgctg ctgctcgtct ccggcttcgc cgcgttcgcg       240
     accgacctcg tcgcgccgtg gtggcagatc acctcgatcg cgttcgggat cggcgccggc       300
     ttcacgctcg acgagttcgc gctgtgggtg cggctgcagg acgtctactg gtccgacgag       360
     gggcgcgcct cgctcgacgc cgtcgtgctc gcgacggtct tcgcagggct cgtcgtgttc       420
     ggcgtcaacc cgtacggcct cgacgaggcc ggctcgatcg tcggcacggc cgcctggttc       480
     gcgctgacgc tcgcgttcgc cgggatcgcc ttcttcaagg ggcggatggt gctcgggatg       540
     gtggcgatct tcgtcccgtt cgtcgccggt gcctgggcgg cggtccggct cgcgaagccg       600
     acgtcgccgt gggcgcgccg ctacgacgcc gacaagctcg cgcgcgccag agcccgctac       660
     ggtcccgaca cgcgcggcgc gcgcttcggc agacgcttcc tcgacgcgat cggcggcgcg       720
     ccgtcggagc cggatccgcc gggtccgcct gcgcggcccg gctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page