(data stored in ACNUC7421 zone)

EMBL: CP001854.PE221

CP001854.PE221       Location/Qualifiers
FT   CDS_pept        complement(223999..225342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0221"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   mxa:MXAN_0560 penicillin-resistant dd- carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48657"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3F579"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADB48657.1"
FT                   /translation="MNQEQRDLALDDLWADSLERSLARRGARPRTSSALARLRPRDLAD
FT                   AEFSLDSLMVAQRRREAAAAQTKLPAPAKRGLSLTALLAVTAGPAVGVGGAFTGTAAAA
FT                   PRVALEKGDRGRQVKQLQRALGVHADGIFGPGTKKALRKFQARHGLDVDGVAGSATWSA
FT                   LKRADANTARTSARSGGKKDRIIGHSVRAVQRELGVPADGVFGPQSIKALRKFQDRHGL
FT                   DVDGVVGPATWSALKRDGGGNAGGGRRARSATNEGSGVAALQRALGIAADGEFGPGTEA
FT                   AVKRYQASRGLEADGVAGPATRDALGLGDGPVLKRGGEGRRGGGGSNADAKVAAMIAAG
FT                   NRIATTPYVYGGGHGSFQDSGYDCSGSVSYVLNAGGFLDSPLASGGLMSWGEAGEGKRV
FT                   TVYSNPGHAYMVIDGRRFDTSGQSSAGTRWQANDRSTAGYVARHPAGL"
     gtgaaccagg agcagcgcga tctcgcgctc gatgacctct gggcggactc gctcgagcgt        60
     tcgctcgcac gccgcggcgc gcggccgcgg acgtcctccg cgctcgctcg cctgcgtccg       120
     cgcgatctcg ccgacgccga gttctcgctc gactcgctca tggtcgcgca gcggcgccgc       180
     gaggccgccg cggcgcagac gaagctgccc gcccctgcca agcggggcct gtcgctgacg       240
     gcgctgctcg ccgtcaccgc cggtccggcc gtcggcgtcg gcggcgcgtt caccggcacc       300
     gccgccgcgg cgccgcgcgt cgcgctggag aagggcgaca gaggccgcca ggtcaagcag       360
     ctgcagcgcg cgctcggcgt ccacgccgac ggcatcttcg gccccggcac gaagaaggcg       420
     ctgcgcaagt tccaggcccg ccacgggctc gacgtcgacg gcgtcgccgg ctcggcgacc       480
     tggtcggcgc tcaagcgcgc cgatgccaac acggcacgga caagcgctcg ctcgggcggc       540
     aagaaggacc gcatcatcgg gcacagcgtg cgcgcggtcc agcgcgagct gggcgtgccc       600
     gccgacggcg tcttcggccc gcagtcgatc aaggcgctgc gcaagttcca ggaccgccac       660
     gggctcgacg tcgacggcgt cgtcggcccg gcgacgtggt cggcgctcaa gcgcgacggc       720
     ggcggcaacg cgggcggcgg gcgccgcgcc cgctcggcga cgaacgaggg ctccggcgtc       780
     gccgcgctgc agcgtgcgct cgggatcgcc gccgacggcg agttcggtcc cggcaccgag       840
     gcggccgtca agcgctacca ggccagccgc gggctcgagg ccgacggcgt cgccggcccg       900
     gcgacgcgcg acgcgctcgg cctcggcgac ggccccgtgc tcaagcgcgg cggcgagggc       960
     cggcgcggtg gcggcggcag caacgcggac gcgaaggtcg cggcgatgat cgccgccggc      1020
     aaccggatag cgacgacgcc gtacgtctac ggcggcggcc acggctcgtt ccaggacagc      1080
     ggctacgact gctccggctc ggtctcctac gtgctcaacg ccggcggctt cctcgactcc      1140
     ccgctcgcct ccggcgggct gatgagctgg ggcgaggccg gcgagggcaa gcgcgtgacg      1200
     gtctactcca accccggtca cgcgtacatg gtgatcgacg gcagacgctt cgacacgagc      1260
     ggccagagct ccgccggcac gcgctggcag gcgaacgacc gctcgaccgc cggctacgtc      1320
     gcccgccacc cggcgggcct ctga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page