(data stored in ACNUC7421 zone)

EMBL: CP001854.PE222

CP001854.PE222       Location/Qualifiers
FT   CDS_pept        225601..226401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0222"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; putative RNA
FT                   methylase; KEGG: afw:Anae109_1601 methyltransferase type
FT                   11"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48658"
FT                   /db_xref="GOA:D3F5Y5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Y5"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB48658.1"
FT                   /translation="MTGRGGIWALGDFAKVARETITGTGDVLVEACGIGPGQRVLDVAA
FT                   GSGNVAIPAARAGADVVASDITPELLEAGRAEAAQQGVTLEWVEADAQALPFDDDAFDV
FT                   VTSSFGVMFAPDQPAAAAELVRVCRPGGTIGLVNWTPGSWVAQFFATLLPFRPPPPPGF
FT                   QPPVMWGEESHLRELLGAGIETLRTERHTVVVDRFPDPAAIVSYYAAYFGPVVAARAAL
FT                   GDDPTRLAELDRALLELAERTDGGPPGGPARYELEYLLAVARVT"
     gtgaccggac ggggcggaat ctgggcgttg ggcgacttcg cgaaggtggc gcgcgagacc        60
     atcacgggca ccggcgacgt gctcgtcgag gcatgcggca tcggtcccgg acagcgcgtg       120
     ctcgacgtcg ccgcaggctc cgggaacgtt gcgatcccgg cggcccgcgc gggcgccgac       180
     gtcgtcgcga gcgacatcac gccggagctg ctggaggccg gtcgtgcgga ggcggcgcag       240
     cagggcgtca cgctcgaatg ggtcgaggcc gacgcgcagg cactgccgtt cgacgacgac       300
     gcgttcgacg tcgtcacctc ctcgttcggc gtgatgttcg cgcccgacca gcccgccgcc       360
     gcggccgagc tggtgcgcgt ctgccgtccc ggcggcacga tcggcctcgt caactggacg       420
     cccgggagct gggtggcgca gttcttcgcg acgctgctgc cgttccgccc gccgcccccg       480
     cccggcttcc agccgccggt catgtggggc gaggagtcgc acctgcgcga gctgctcggc       540
     gccgggatcg aaacgctgcg gaccgagcgc cacacggtcg tcgtcgaccg cttccccgat       600
     ccggcggcga tcgtctccta ctacgccgcc tacttcggcc ccgtcgtcgc ggcgcgggcc       660
     gcgctcggcg acgaccccac gcggctcgcg gagctggacc gcgcgctgct ggagctggcc       720
     gagcggaccg acggcggccc gcccggcgga cccgcgcgct acgagctgga gtacctgctc       780
     gcggtcgcgc gggtcacctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page