(data stored in ACNUC7421 zone)

EMBL: CP001854.PE223

CP001854.PE223       Location/Qualifiers
FT   CDS_pept        complement(226425..227693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0223"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   gur:Gura_3474 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48659"
FT                   /db_xref="GOA:D3F5Y6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Y6"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADB48659.1"
FT                   /translation="MSGTAVRRPPRRPPRLRPRRSRRAHDAERLPASRLLPADVMRLGA
FT                   HGLRTRPARAALSALGIAIGVAAMVAVLGVGESSRTRVLDQLAKLGTNLLTVQPGESFF
FT                   GEEVKLPETAARSIRGLPGVEVAAAATTLSQTVRKTDRVPEEESNGIALTAAEPGLLEA
FT                   IGGSLASGRFLDAALARYEAIVLGSLTARRLGIERPGPRVYVGDRWFTVVGIMRPVPLV
FT                   GDLDRAAFIGYPVAKRLFGADRSASAIYVRTREDAVIDTRALLGPTANPQRPEEVAVSR
FT                   PSDALAAKAATEDALTALLLGLGAVALLVGGIGIANVMVIAVLERRREIGLRRALGATR
FT                   RHVAVQFLCEALLLSLLGGALGVLLGAAGTFAYATSQDVRTVIPAIAIVGGLLASVGMG
FT                   AIAGFYPALRATRLSPTEALRST"
     atgagcggca cggcggtccg ccgccctccg cgccgcccac cgcggctgcg cccgcggcgg        60
     tcacggcgtg cgcacgacgc ggagcgcctg cccgcgagcc ggctgctgcc cgccgacgtg       120
     atgcggctcg gcgcgcacgg cctgcgcaca cgaccggcgc gggccgcgct gtcggccctc       180
     gggattgcga tcggcgtcgc ggcgatggtc gcggtgctcg gcgtcggcga gtcgagccgc       240
     acgcgcgtgc tcgaccagct cgccaagctc ggcacgaacc tgctcaccgt ccagccgggg       300
     gagagcttct tcggcgagga ggtgaagctg ccggagaccg ccgcgcgctc gatccgcggc       360
     ctgccgggag tcgaggtcgc cgccgcggcg acgacgctgt cgcagaccgt gcgcaagacc       420
     gatcgcgtac ccgaggagga gagcaacggc atcgcgctga ccgcggccga gccggggctc       480
     ctggaggcga tcggaggctc gctcgcgagc ggccgcttcc tcgacgccgc gctcgcgcgc       540
     tacgaggcga tcgtgctcgg ctcgctgacc gcgagacggc tcggcatcga gcgccccggc       600
     ccgcgcgtct acgtcggcga ccgctggttc accgtcgtcg ggatcatgag accggttccg       660
     ctcgtcggag acctcgaccg ggccgccttc atcggctacc cggtcgccaa gcgcttgttc       720
     ggggctgacc gcagcgcgtc ggcgatctac gtccgcacga gagaggacgc cgtcatcgac       780
     acgcgtgcgc tgctcgggcc gacggcgaac ccgcagagac ccgaggaggt ggccgtcagc       840
     cgcccgtccg acgcgctcgc cgcgaaggcc gcgaccgagg acgcgctgac cgcgctgctg       900
     ctcggcctcg gcgccgtcgc gctgctcgtc ggcgggatcg gcatcgcgaa cgtgatggtg       960
     atcgccgtgc tggagcgccg ccgcgagatc ggcctgcggc gcgcgctcgg cgcgacgcgg      1020
     cgccacgtcg ccgtccagtt cctctgcgag gcgctgctgc tgtcgctgct cggcggagcg      1080
     ctcggggtgc tgctcggcgc ggccggcacc ttcgcgtacg cgacgagtca ggacgtgcgc      1140
     acggtgatcc cggcgatcgc gatcgtcggc ggcctgctgg cgtcggtcgg gatgggcgcg      1200
     atcgccggct tctacccggc gctgcgcgcg acgcggctgt cgccgaccga ggcgctgcgc      1260
     tccacctga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page