(data stored in ACNUC7421 zone)

EMBL: CP001854.PE224

CP001854.PE224       Location/Qualifiers
FT   CDS_pept        complement(227690..228346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0224"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vha:VIBHAR_02834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48660"
FT                   /db_xref="GOA:D3F5Y7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Y7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB48660.1"
FT                   /translation="MTPVLELDHVTKTYPGVTALDDVSLRIDAGELIAIVGPSGSGKST
FT                   LLQIMGTLDRPTDGRVLIEGRDAAECDDGELAALRARRIGFVFQQFFLLDGASALDNVA
FT                   DGLLYTGTPRAQRRERAADALERVGLAARAHHAPNALSGGERQRVGIARAIVAKPAIVL
FT                   ADEPTGALDSARGAEIVALMRELNDAGTTLAIITHDRELAGGLPRQVSVRDGRLS"
     atgacgcccg tgctcgagct cgaccacgtg acgaagacgt acccgggcgt gaccgcgctc        60
     gacgacgtct cgctgcggat cgacgcgggc gagctgatcg cgatcgtcgg gccgtccggt       120
     tcgggcaagt cgacgctgct gcagatcatg ggcacgctcg accgcccgac cgacggccgc       180
     gtgctgatcg agggccgcga cgccgccgag tgcgacgacg gcgagctggc ggcgctgcgt       240
     gcgcgccgga tcggcttcgt cttccagcag ttcttcctgc tggacggggc gagcgcgctc       300
     gacaacgtcg ccgacggcct gctctacacc ggcacgccgc gcgctcagcg acgcgagcgc       360
     gcggccgacg cgctcgagcg cgtaggcctc gccgcccgcg cacaccacgc gccgaacgcg       420
     ctctcgggcg gggagcgcca gcgcgtcggg atcgcacgcg cgatcgtcgc caagcccgca       480
     atcgtgctcg ccgacgagcc gaccggcgcg ctcgacagcg cgcgcggcgc ggagatcgtc       540
     gcactgatgc gcgagctgaa cgacgccggc acgacgctcg cgatcatcac gcacgatcgc       600
     gagctggcgg gtgggctccc gcgccaggtc tccgtgcgtg acgggcggct gtcatga          657
//

If you have problems or comments...

PBIL Back to PBIL home page