(data stored in ACNUC7421 zone)

EMBL: CP001854.PE225

CP001854.PE225       Location/Qualifiers
FT   CDS_pept        complement(228343..230160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0225"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   predicted gene, 100041170"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48661"
FT                   /db_xref="GOA:D3F5Y8"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Y8"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADB48661.1"
FT                   /translation="MRRGDHADGSHVPGEVTRRRAAVGIALPLAALAAVAAVVIASSGG
FT                   SGASGGSASASTTPMGTARVERRTLVEQKALDGTLGYDDPQPAVDRLGGTLTWLPRTGA
FT                   TIRPGQRLFSVDGEPVVLMDGTVPAWRTLKEGIDDGEDVRQLEQNLAALGYDPGTVDDD
FT                   FTSSTADAVERWQDAWDLKETGEVELGRIVFLPGARRIAEVKGSLGGTGGSSGGGGDSV
FT                   AWDGGSAAGGLRTMAVSDMSSGGAPVAAATGTSTTPAPGATTPADPGNGTGGTGGTGGT
FT                   GGDGGAGTGGGTDRGETGRGGTGRGGTGGGGNGGTGNGGTGRGGTGGGGNGGTGNGGTD
FT                   GGTGRGGNGGNGGTGRGGNGGNGGTGRGGNGGTGNGETGRGGTGGAVGTTPGGTTGGAG
FT                   GGATGGSPMDGAAGGGSGAGGTGGGTDGGAGDGGSGDGGGAGGGSEVLSTTSTRRVVTA
FT                   DLDAADQALAKVGRKATVVLPDGTSIGGRVTDVGAVASAGDGDGGSGGEEAEDPTLPLT
FT                   IELDSARRLGQLDEAPVSVELAATTRKNVLAVPVAALIARPGGGYAVRVVGASGTTRDV
FT                   PVEPGMFADGWVELTGDSVRAGERVEVPR"
     atgcggcggg gggatcacgc cgatggctcc cacgtccccg gcgaagtgac tcgcagacgc        60
     gcagcagtcg ggatcgcgct gccgctggcg gcgctcgcgg cggtcgccgc cgtcgtgatc       120
     gccagcagcg gcggcagcgg cgcgagcggc ggctccgcct cggccagcac gacgccgatg       180
     ggaactgcgc gggtcgagcg gcgcacgctc gtcgagcaga aggcgctcga cggcacgctc       240
     ggctacgacg acccgcagcc ggcggtcgac cggctcggcg gaacgctgac gtggctgccg       300
     agaaccgggg cgacgatccg ccccggccag cggctgttct ccgtcgacgg cgagccggtc       360
     gtcctgatgg acggaaccgt gccggcgtgg cggacgctga aggaggggat cgacgacggt       420
     gaggacgtcc gtcagctgga acagaacctc gccgcgctcg gctacgaccc gggcacggtc       480
     gacgacgact tcacctccag caccgccgac gcggtcgagc gctggcagga cgcatgggac       540
     ctgaaggaga ccggcgaggt cgagctcggc cggatcgtct tcctgccggg ggcccggcgg       600
     atcgccgagg tgaagggctc gctcggcggg accggcggca gcagcggagg cggtggcgac       660
     agcgtcgcct gggacggcgg cagcgcggcg ggcgggctgc ggacgatggc ggtctccgac       720
     atgtcgagcg gaggcgcccc ggtcgcggcg gcgaccggga cgtccacgac ccccgctccg       780
     ggcgcaacga cgccggccga ccccggcaac gggaccggcg ggaccggcgg gaccggcggg       840
     accggcggcg acggcggggc cgggaccggt ggggggaccg atagaggcga gaccggcaga       900
     ggcgggaccg gcagaggcgg gacgggtggc ggcggcaacg gcggcaccgg gaacggcggc       960
     actggcagag gcgggacggg tggcggcggc aacggcggca ccgggaacgg cgggaccgac      1020
     ggcgggacgg gcagaggcgg gaacggcggg aacggcggga cgggcagagg cgggaacggc      1080
     gggaacggag ggacgggcag aggcgggaac ggcggcaccg gaaacggcga gaccggcaga      1140
     ggcggcaccg gcggcgccgt cggcacgaca cccggcggca cgaccggcgg cgcaggcggc      1200
     ggcgcgacgg gcggcagccc gatggacggc gcggccggcg gcgggagcgg ggccggcggg      1260
     accggcggcg ggactgacgg cggcgcgggc gacggcggga gtggcgacgg cggcggcgcc      1320
     ggcggcggga gcgaggtgct gtcgacgacc tcgacgcggc gcgtcgtcac cgccgacctc      1380
     gacgcggccg accaagcgct tgccaaggtc ggccgcaaag cgacggtcgt gctgcctgac      1440
     gggacctcga tcggcgggcg cgtcacggac gtcggcgcgg tcgcgagcgc cggcgacggc      1500
     gacggcggca gcggcggcga ggaggcggag gacccgacgc tgccgctgac gatcgagctc      1560
     gactccgcga gacgtctcgg gcagctcgac gaggcgcccg tcagcgtcga gctggcggcg      1620
     acgacgcgca agaacgtgct ggcagtgccg gtcgcggcgc tgatcgcccg cccgggcggc      1680
     ggctacgcgg tgcgggtcgt gggcgcgtcc ggcacgacgc gcgatgtgcc ggtcgagccc      1740
     ggcatgttcg ccgacggctg ggtcgagctg accggtgact cggtcagagc cggcgagcgc      1800
     gtcgaggtgc cgcgatga                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page