(data stored in ACNUC7421 zone)

EMBL: CP001854.PE226

CP001854.PE226       Location/Qualifiers
FT   CDS_pept        complement(230112..230633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48662"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Y9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48662.1"
FT                   /translation="MPGITRPLLALLAAAFTVLTLAACGGDDKSDGSGSGSSEQEKALA
FT                   FQDCLRDRGLNATIDDRGRMMMRADAVRSGDAGDAAAPSMDGMPEAMEECRKSTGWEPP
FT                   APSEQERAEMQDRTLRFAQCMRAEGVDVPDPTGDGRMTMRIDGNREAFERAAKKCGGGI
FT                   TPMAPTSPAK"
     gtgccaggaa tcacacgccc gctgctcgca ttgctcgcgg cggcattcac cgttctcacg        60
     ctcgccgcct gcggcggcga cgacaagtcg gacgggtccg gctcgggctc gagcgagcag       120
     gagaaggcgc tcgcgttcca ggactgcctg cgcgacagag ggctcaacgc gacgatcgac       180
     gacagaggcc ggatgatgat gagagcggat gccgtcagat ccggcgacgc cggcgacgct       240
     gcggcgccct cgatggacgg gatgccggag gcgatggagg aatgccgcaa gagcaccggc       300
     tgggagccgc ccgccccgag cgagcaggag agagccgaga tgcaggacag aacgctcaga       360
     ttcgcgcagt gcatgcgcgc cgagggcgtc gacgtgcccg acccgaccgg ggacgggcgg       420
     atgacgatga gaatcgacgg caacagagag gcgttcgagc gcgcagccaa gaaatgcggc       480
     ggggggatca cgccgatggc tcccacgtcc ccggcgaagt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page