(data stored in ACNUC7421 zone)

EMBL: CP001854.PE227

CP001854.PE227       Location/Qualifiers
FT   CDS_pept        complement(230704..232152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0227"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   xcv:XCV0335 two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48663"
FT                   /db_xref="GOA:D3F5Z0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB48663.1"
FT                   /translation="MSFRRRVVLLVAAAVATAILGASALVYVVMRSELYAQLDERLRAQ
FT                   APQAFFLPTSTERALGVQPPRGERRLKVLMRAPSDTITFPLPLSELSLYERARKTRGRI
FT                   VVPGPLGASTAVAQLVNVNGAVLGDDIGGPTLPTSDRTFAVAARQADAFFSDAEVDGVD
FT                   VRMLTVAGPDGSALTVAEPREDVDSALRRLLAILIGVSGTGVAAAAGLGVLVSRRALVP
FT                   VVHLTDATEHVAATQDLSRRIDVHGGDELARMATSFNTMLAALDGARAAQRQLVSDASH
FT                   ELRTPLTAVRTSIEALAGAPDLPAAERARVLDAARVQLEDLSVLVGDLVDLARPAAPAE
FT                   EVEDVRLDLLVGEAVERARRHAPDATFRLDASESLVRAAPGRLHRAVGNLLDNAVKHGG
FT                   ADGSVDVCVRGGEVRVRDHGPGIAPEDLPHVFDRFYRARRARGLPGAGLGLAIVRQVAE
FT                   AHGGSVRAESPDDGGARLVLSLPS"
     atgagcttcc ggcggcgtgt cgtcctgctc gtcgccgccg ccgtcgcgac ggcgatcctc        60
     ggcgcctccg cgctcgtcta cgtcgtgatg cgcagcgagc tgtacgcgca gctcgacgag       120
     cggctgcgag cgcaggcgcc gcaggcgttc ttcctcccga ccagcaccga gcgggcgctc       180
     ggcgtccagc cgcccagagg ggagagacgc ctgaaggtgc tgatgcgcgc gccgagcgac       240
     acgatcacgt tcccgctgcc gctcagcgaa ctgtcgctgt acgagagagc gcggaagacg       300
     agagggcgga tcgtcgtgcc cgggccgctc ggcgcctcga ccgccgtcgc gcagctcgtg       360
     aacgtgaacg gcgccgtgct cggcgacgac atcggcgggc cgacgctgcc gacgagcgac       420
     cgcaccttcg cggtcgcggc gagacaggcc gacgcgttct tctccgacgc cgaggtcgac       480
     ggcgtcgacg tgcggatgct gacggtcgcc gggccggacg gctcggcgct gaccgtcgcc       540
     gagccgcgcg aggacgtcga cagcgcgctg cggcggctgc tggcgatcct gatcggcgtc       600
     agcggcaccg gcgtcgccgc ggccgccggg ctcggcgtgc tcgtctcgcg gcgcgcgctc       660
     gtgccggtcg tgcacctgac cgacgcgacc gagcacgtcg ccgcgacgca ggacctgagc       720
     cggcggatcg acgtccacgg cggcgacgag ctggcgcgga tggcgacgag cttcaacacg       780
     atgctcgccg cgctcgacgg cgcacgggcg gcgcagcggc agctcgtctc cgacgcatcg       840
     cacgagctgc gcacgccgct gaccgcggtg cggacgtcga tcgaggcgct cgcgggcgcg       900
     cccgacctgc cggcggcgga gcgcgccaga gtgctcgacg ccgcgcgcgt gcaactggag       960
     gacctgagcg tgctcgtcgg cgacctcgtc gacctggcgc ggccggcggc gccggccgag      1020
     gaggtcgagg acgtgcggct cgacctgctc gtcggcgagg cggtcgagcg cgcgcggcgc      1080
     cacgcgccgg acgcgacctt ccggctcgac gcgagcgagt cgctcgtgcg cgcggcgccg      1140
     ggacggctcc accgcgccgt cggcaacctg ctcgacaacg ccgtcaagca cggcggcgcc      1200
     gacggctcgg tggacgtgtg cgtccgtggc ggcgaggtgc gcgtgcgcga ccacgggccc      1260
     ggcatcgcgc cggaggacct gccgcacgtc ttcgaccgct tctaccgcgc gcgccgcgcg      1320
     cgcggtctgc cgggcgcggg cctcggcctc gcgatcgtgc ggcaggtcgc cgaggcgcac      1380
     ggcggcagcg tgcgcgccga gtcgccggac gacggcggcg cacggctggt cctctcactt      1440
     ccctcctag                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page