(data stored in ACNUC7421 zone)

EMBL: CP001854.PE228

CP001854.PE228       Location/Qualifiers
FT   CDS_pept        complement(232149..232820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0228"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: gme:Gmet_3383 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48664"
FT                   /db_xref="GOA:D3F5Z1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB48664.1"
FT                   /translation="MVVDDEPAMREALELALRLDGFEVELASDGRDAIRRLPGARPDVV
FT                   LLDVLMPELDGIEVCRRMRDAGDRTPVLMLTARDEVDDRVAGLEAGADDYLSKPFALPE
FT                   LLARLHALLRRTGWAADAELLRFEDLELDPAACEAKRGGQTLELTRTEFLLLELFLRNP
FT                   RQVLTRAVIVERVWGYDFGPTSNSIEVYVGYLRRKTEAAGASRLLHTVRGVGYVLRQAT
FT                   T"
     atggtcgtcg acgacgagcc ggcgatgcgc gaggcgcttg agcttgcgct gcggctggac        60
     gggttcgagg tcgagctggc cagcgacggc cgcgacgcga tccgccggct gccgggcgca       120
     cgccccgacg tcgtcctgct cgacgtgctg atgcccgagc tggacgggat cgaggtctgc       180
     cgccggatgc gcgacgcggg cgaccgcacg ccggtgctga tgctgaccgc gcgcgacgag       240
     gtcgacgacc gcgtcgcggg cctggaagcc ggcgccgacg actacctctc caagccgttc       300
     gcgctgccgg agctgctcgc gcgcctgcac gcgctgctgc gccgcaccgg ctgggcggcc       360
     gacgccgagc tgctgcgctt cgaggacctc gagctcgacc cggccgcgtg cgaggcgaag       420
     cgcggcgggc agacgctgga gctgacgcgg acggagttcc tgctgctgga gctgttcctg       480
     cgcaacccac ggcaggtgct gacgcgcgcg gtgatcgtcg agcgcgtctg gggctacgac       540
     ttcggcccga cgtcgaactc gatcgaggtc tacgtcggct acctgcggcg caagacggag       600
     gccgcgggcg cgtcgcgcct gctgcacacg gtgcgcggcg tcggctacgt gctgcggcag       660
     gcgacgacat ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page