(data stored in ACNUC7421 zone)

EMBL: CP001854.PE229

CP001854.PE229       Location/Qualifiers
FT   CDS_pept        complement(232886..233710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0229"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bxe:Bxe_B0860 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48665"
FT                   /db_xref="GOA:D3F5Z2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADB48665.1"
FT                   /translation="MATIEIPHGTRSGVGPLLRGWRQRRRLSQLDLALEAGVSARHLSF
FT                   VETGRSKPSSEMVLHLAEQLDVPLRERNQLLLAAGYAPVFGERELDAPEMAPVHDAIQR
FT                   VLDGHDPYPAVVVDRTWNLVAANHSLALLTDGVSPELLRPPGNAMRLSLHPDGLAPRIV
FT                   NLGEWRDHLLARLARQVAATGDAKLSALLEEVAAYPAPDGVPEPPATAAGHDLAEQIAV
FT                   PLRLRHGDGELRFISIVATFGTAVDITVAELSIESFFPADEATAEAVRAHAG"
     atggcgacga tcgagatccc tcacggcacc cgctccggcg tcggcccgct gctgcgcggt        60
     tggcggcagc ggcgccggct gagccagctc gacctcgcgc tcgaggccgg cgtctccgcg       120
     cgccacctga gcttcgtcga gaccggccgc tcgaagccca gctccgagat ggtcctccac       180
     ctcgccgagc agctcgacgt gccgctgcgc gagcgcaacc agctgctgct cgccgccggc       240
     tacgcccccg tcttcggcga gcgcgagctg gacgcgcccg agatggcgcc cgtgcatgac       300
     gcgatccagc gcgtgctcga cggtcacgac ccgtacccgg ccgtcgtcgt cgaccgcacc       360
     tggaacctcg tcgcggccaa ccacagcctc gcgctgctga ccgacggcgt cagccccgag       420
     ctgctgcgcc cgcccggcaa cgcgatgcgg ctgtcgctgc atcccgacgg gctcgcgccg       480
     cggatcgtca acctcggcga gtggcgcgac cacctgctcg cgcggctcgc ccgccaggtc       540
     gcggcgaccg gcgacgcgaa gctgagcgcg ctgctggagg aggtcgccgc ctacccggcg       600
     cccgacggcg tgcccgagcc gcccgcgacc gccgccggcc acgacctcgc cgagcagatc       660
     gccgtcccgc tgcggctgcg gcacggcgac ggcgagctgc gcttcatctc gatcgtggcg       720
     acgttcggga ccgcggtcga catcaccgtc gcggagctgt cgatcgagtc gttcttcccg       780
     gccgacgagg cgacggcgga ggccgtccgc gcgcacgccg gctga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page