(data stored in ACNUC7421 zone)

EMBL: CP001854.PE23

CP001854.PE23        Location/Qualifiers
FT   CDS_pept        complement(27180..27731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: har:HEAR1931 putative type I secretion
FT                   membrane fusion protein, HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48459"
FT                   /db_xref="GOA:D3F3X6"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3X6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48459.1"
FT                   /translation="MSATALPHGGTGLPVDPLLTNDVVAHLDAQITSAARLLEIAMAQA
FT                   AAIAERDVDAVVRQITAFQAELERRTRIEDERARLLARAGAALRLSPAEVTITRITLLM
FT                   GPAEAQIAASRSAELQGLLSELSARHASNQALMRQELAFLDHLLNLIEPVTALGYEQGG
FT                   GRNTMPAAPLPGHHALDLHA"
     gtgagcgcca ccgctctccc gcacggcggc accggcctgc cggtcgaccc gctgctgacc        60
     aacgacgtgg tcgcccacct cgacgcgcag atcacctccg ccgcacgcct gctggagatc       120
     gcgatggcac aggccgccgc gatcgccgag cgcgacgtcg acgcggtcgt gcgccagatc       180
     accgcgttcc aggcagagct ggagcgacgc actcggatcg aggacgagcg cgcacggctg       240
     ctcgcacgcg ccggggccgc gctgcggctg tcgccggccg aagtgacgat cacgcggatc       300
     acgctgctga tgggccccgc cgaggcgcag atcgcggcgt cccgcagcgc cgagctgcag       360
     gggctgctgt ccgagctgtc cgctcgtcac gcctccaacc aggcgctgat gcggcaggag       420
     ctcgccttcc tcgaccacct gctgaacctg atcgaacccg tcaccgcgct cggctacgag       480
     cagggcggcg ggcgcaacac catgccggcg gcgccgctgc cgggtcacca cgccctcgac       540
     cttcacgcct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page