(data stored in ACNUC7421 zone)

EMBL: CP001854.PE230

CP001854.PE230       Location/Qualifiers
FT   CDS_pept        233806..234249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0230"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48666"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48666.1"
FT                   /translation="MEITDAPTAARQSRAGTQDEDAIRAVIADVETGFNTNDADLLSRH
FT                   FAGDAKVVAAFGQTIDGREAIDEANRQGVASPFLKDATAHYTVSSITFVEEDVALVRKL
FT                   AWSTAEDESAGKPPEMVALYVFVRRDGRWWIAARQNTLIGQPA"
     atggaaatca cggatgcacc cacagcagct cgccaatcgc gcgccgggac gcaggacgag        60
     gacgcgatcc gcgccgtcat cgccgacgtc gagaccgggt tcaacacgaa cgacgccgat       120
     ttgctgagca ggcacttcgc cggagatgcg aaggtcgtgg ccgccttcgg gcagacgatc       180
     gacggccggg aggcgatcga cgaggccaac cggcagggcg tcgcctcccc ctttctcaag       240
     gacgccacgg cgcactacac ggtctcctcg atcacgttcg tcgaggagga cgtcgccctc       300
     gtccgcaagc tcgcctggtc caccgcggag gacgagtcgg ccgggaagcc gccggagatg       360
     gtcgcgctct acgtcttcgt ccgtcgcgac gggcggtggt ggatcgcggc tcgccagaac       420
     accctcatcg gccagccggc gtga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page