(data stored in ACNUC7421 zone)

EMBL: CP001854.PE231

CP001854.PE231       Location/Qualifiers
FT   CDS_pept        complement(234277..234879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0231"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_4263
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48667"
FT                   /db_xref="GOA:D3F5Z4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48667.1"
FT                   /translation="MAAPPTRPALRRRYDAKRDGVVETAAELFAGRGYHATRMQDVTAA
FT                   TGLTAGGLYHYFGSKEQLLIAICDALMEPLLSKVEALGIDELEAQLALRALVAAWVAHV
FT                   AAHRQHMIVFLQERHVIEREPQWRHVAASRKRFERLLERTLERVEREGGVAFADRRLTT
FT                   FALLGMVNHLPQWYRPRGRLSVEQIADGFCDMVLPAA"
     atggcagccc ctccgacacg tcccgccctg cggcggcgct acgacgcgaa gcgcgacggg        60
     gtcgtggaga cggcggccga gctgttcgcc ggtcgcgggt accacgcgac gcggatgcag       120
     gacgtgaccg cggcgaccgg gctcacggcc ggcgggctct accactactt cggcagcaag       180
     gagcagctgc tgatcgcgat ctgcgacgcg ctgatggaac cgctgctgag caaggtcgag       240
     gcgctcggga tcgacgagct ggaggcccag ctggcgctgc gggcgctcgt cgccgcctgg       300
     gtcgcgcacg tcgccgcgca ccgccagcac atgatcgtct tcctgcagga gcggcacgtg       360
     atcgagcgcg agccgcagtg gagacacgtc gccgcgagcc gcaagcgctt cgagcggctg       420
     ctggagcgga cgctggagcg ggtcgagcgc gagggcggcg tcgcgttcgc cgaccgccgc       480
     ctcaccacgt tcgcgctgct cggcatggtc aaccacctgc cgcagtggta ccgcccccgc       540
     ggccgcctgt cggtcgagca gatcgccgac ggcttctgcg acatggtgct gcccgccgcc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page