(data stored in ACNUC7421 zone)

EMBL: CP001854.PE232

CP001854.PE232       Location/Qualifiers
FT   CDS_pept        234950..236098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0232"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: dal:Dalk_4346
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48668"
FT                   /db_xref="GOA:D3F5Z5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z5"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB48668.1"
FT                   /translation="MDFDLSDDHRLLRSTVRDFAEQEIAPVAEELDRTKAFPYDIVRRL
FT                   GELNLMGIPFPEEVGGAGADTLAYAIAVEELARIDSSVAITLCAHTSLGTQPIYLFGSE
FT                   EQKRDWLPRLTAGERLGAFGLTEPEAGSDAGNVQTRATLDNGEWVVNGAKQFITNAGTD
FT                   ISGCVVITAVTGTDDRGRKEISNILVPNGTPGYEQGTPYRKMGWNASDTRPLTFTDCRV
FT                   PEDQLVGPRGAGFKQFLRVLDIGRIGVAAMGVGLAQGALDEAVKYSKERKAFGQPISKF
FT                   QAIQGKLADVATELAAARLLTYNAAFLKDRGRDFSLTAAQAKLKTGRLAVRASEEAVQI
FT                   HGGYGYIEEYPVCRFYRDAKILTIGEGTDEVQQMVIARALGA"
     atggacttcg acctctccga cgaccaccgg ctgctgcgga gcacggtgcg cgacttcgcc        60
     gagcaggaga tcgcgcccgt ggcggaggag ctggaccgca cgaaggcgtt cccgtacgac       120
     atcgtgcggc gcctcggcga gctgaacctg atggggatcc cgttccccga ggaggtcggc       180
     ggcgccggcg ccgacacgct cgcgtatgcg atcgcggtcg aggagctggc gcggatcgac       240
     tcctccgtcg cgatcacgct ctgcgcccac acgtcgctcg gcacgcagcc gatctacctg       300
     ttcggctccg aggagcagaa gcgcgactgg ctcccgagac tgaccgccgg cgagcggctc       360
     ggcgccttcg gcctgaccga gcccgaggcc ggctccgacg ccggcaacgt ccagacccgc       420
     gcgacgctcg acaacggcga gtgggtcgtc aacggcgcca agcagttcat caccaacgcc       480
     ggcacggaca tctccggctg cgtcgtgatc accgccgtca ccggcaccga cgaccgcggc       540
     cgcaaggaga tctcgaacat cctcgtcccg aacgggacgc ccggctacga gcagggcacg       600
     ccgtaccgca agatgggctg gaacgcgtcg gacacgcgcc cgctgacgtt caccgactgc       660
     cgcgtgccgg aggaccagct cgtcggcccg cgcggtgccg gcttcaagca gttcctgcgc       720
     gtgctcgaca tcggtcgcat cggcgtcgcc gcgatgggcg tcggcctcgc gcagggcgcg       780
     ctcgacgagg cggtcaaata ctcgaaggag cgcaaggcgt tcggccagcc gatctcgaag       840
     ttccaggcga tccaggggaa gctggccgac gtcgcgaccg agctggccgc ggcgcggctg       900
     ctgacctaca acgccgcctt cctgaaggac agaggccgcg acttctcgct gaccgccgcg       960
     caggcgaagc tgaagaccgg ccggctcgcc gtccgcgcga gcgaggaggc ggtccagatc      1020
     cacggcggct acggctacat cgaggagtac ccggtctgtc gcttctaccg cgacgcgaag      1080
     atcctcacga tcggcgaggg caccgacgag gtgcagcaga tggtgatcgc ccgcgcgctg      1140
     ggcgcctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page