(data stored in ACNUC7421 zone)

EMBL: CP001854.PE233

CP001854.PE233       Location/Qualifiers
FT   CDS_pept        236098..237030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0233"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   ade:Adeh_1644 hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48669"
FT                   /db_xref="GOA:D3F5Z6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z6"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADB48669.1"
FT                   /translation="MGAVGLPARVHVREVGPRDGFQNEPETIATADKVALVNALARTGL
FT                   SRLEVTSFVRADVIPQLADAVELLGAIDVPDHVSVSVLVPNARGLDAALEVRDRFDEVN
FT                   VFLSASESHNRANVNRSVAESLDGIGRVAERARAAGLRCQGTISTAFGCPYEGRVPVER
FT                   ALEIARALHDLGCEEVGFGDTTGMANPVQVRAFFARATAELGEQVELTAHFHNTRGQGL
FT                   ANVLAALDAGCRSFESSFGELGGCPQSGPTHPATGNIASEDLVSMLHEMGVETGIDLAA
FT                   LIGASRAARDVLGRPLGSHVLTAGPVEWR"
     atgggcgcgg tcggccttcc cgcccgcgtg cacgtgcgcg aggtcgggcc gcgcgacggc        60
     ttccagaacg agccggagac gatcgcgacc gctgacaagg tcgcgctcgt gaacgcgctc       120
     gcgcgcaccg gcctcagccg cctcgaggtc acctcgttcg tccgcgccga cgtgatcccg       180
     cagctcgccg acgcggtcga gctgctgggc gcgatcgacg tgcccgacca cgtctcggtc       240
     tccgtcctgg tgccgaacgc gcgcgggctc gacgcggcgc tggaggtgcg tgaccgcttc       300
     gacgaggtca acgtcttcct gtccgcctcg gagtcgcaca accgcgcgaa cgtcaatcgc       360
     tccgtcgccg agtcgctcga cgggatcggc cgcgtcgccg aacgggcgcg cgcggcgggc       420
     ctgcgctgcc agggcacgat ctcgaccgcc ttcggctgtc cctacgaggg ccgcgtgccg       480
     gtcgagcgcg cgctggagat cgcccgcgcg ctgcacgacc tcggctgcga ggaggtcggc       540
     ttcggcgaca cgaccgggat ggccaacccg gtgcaggtgc gcgccttctt cgcgcgcgcg       600
     accgccgagc tgggcgagca ggtcgagctg accgcccact tccacaacac gcgcggccag       660
     ggcctcgcga acgtgctcgc cgcgctcgac gccggctgcc gctcgttcga gtcgagcttc       720
     ggcgagctgg gcggctgccc gcaatcaggt cccacccacc cagcgaccgg caacatcgcg       780
     agcgaggacc tcgtctcgat gctgcacgag atgggcgtcg agaccggcat cgacctggcg       840
     gcgctgatcg gcgcctctcg cgcggcgcgc gacgtgctcg gccggccgct cggctcgcac       900
     gtgctgacgg cggggcctgt cgaatggcgc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page