(data stored in ACNUC7421 zone)

EMBL: CP001854.PE234

CP001854.PE234       Location/Qualifiers
FT   CDS_pept        237021..239096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0234"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain ATP-
FT                   binding; biotin carboxylase domain protein; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   biotin/lipoyl attachment domain-containing protein;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   KEGG: reu:Reut_B4460 carbamoyl-phosphate synthase subunit
FT                   L"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48670"
FT                   /db_xref="GOA:D3F5Z7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z7"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ADB48670.1"
FT                   /translation="MALIDTLSPVLIANRGEIAVRIERTLRRLGLGSVAVYSDADAGAP
FT                   HVLAADTAVRIGPADARSSYLSIPALLDAARVTGARAVHPGYGFLAESAPFAQAVIDAG
FT                   LTWIGPPPPAIELMGDKARAKQLAREAGVPVVPGIDGADLTYEQIDAFAAEHGFPVVVK
FT                   AVAGGGGKGMRVVRAATELRGALDAARREAAAAFGDDRVLVERYLERPRHIEVQVLADA
FT                   HGAVVHLGERECSLQRRHQKVVEEAPSPVVDPDWRAEMGAAAVRLAQACGYAGAGTVEL
FT                   IVPGGSGDVLSGEFFFLEMNTRLQVEHPVTELVYGVDLVEQQLRVAAGEPLALTQDELR
FT                   PRGHAVEARLYAEDPAAGFLPSTGVVRRWRAPAGTGVRSDDALADGVAVQTHYDPMLAK
FT                   LIAHGPDRATALARLDRALAELELLGVTTNAAFTRGLLAREDVRAGQMDTGLLERVLAG
FT                   GEEGGASPAAGTAASGPAAAGAAASGRVAGLAPLDDLLPAAALTLALADADALGAHTSV
FT                   PLGWRSDGAAGTWRRRVVPGGGDAVELCVRGETVTVGERTWCGRATRSGEHAVEVELDG
FT                   VARRYAIATGDGDGRLWIGRAGQQLELAPARAGGADLSAAGDSLAAPMPGTILLVHVSD
FT                   GDAVREGDVLVVMESMKMELSVTAPHDGTVDGLTVKAGDRVALREVLLAVHGEDAA"
     atggcgctga tcgacacgct ctcgcccgtc ctgatcgcca accgcggtga gatcgcggtg        60
     cggatcgagc gcacgctgcg gcgtctcggg ctcggctccg tcgcggtcta cagcgacgcc       120
     gacgccggcg cgccgcacgt cctcgcggcc gacacggcgg tgcggatcgg cccggccgac       180
     gcgcgctcct cctacctctc gatccccgcg ctgctcgacg ccgcgcgcgt gacgggcgcg       240
     cgcgccgtcc accccggcta cggcttcctc gccgagagcg cgccgttcgc gcaggccgtg       300
     atcgatgccg gcctgacctg gatcggcccg ccgccgccgg cgatcgagct gatgggcgac       360
     aaggcgcgcg ccaagcagct cgcgcgcgaa gcgggcgtgc cggtcgtgcc cgggatcgac       420
     ggcgccgacc tgacgtacga gcagatcgac gcgttcgccg ccgagcatgg cttccccgtc       480
     gtcgtgaagg cggtcgcggg cggcggcggc aaggggatgc gggtcgtgcg cgcggcgacg       540
     gagctgcgcg gcgcgctcga cgccgcgcgg cgcgaggccg cggcggcgtt cggcgacgac       600
     cgcgtgctgg tcgagcgcta cctggagcgg ccgcggcaca tcgaggtgca ggtgctggcc       660
     gacgcgcacg gcgcggtcgt ccacctcggc gagcgcgagt gctcgctcca acgccgccac       720
     cagaaggtcg tcgaggaggc gccgtcgccc gtcgtcgacc ccgactggcg cgccgagatg       780
     ggcgctgccg cggtgcggct cgcgcaggcg tgcggctacg ccggcgccgg cacggtcgag       840
     ctgatcgtgc cgggcggcag cggcgacgtg ctctcgggtg agttcttctt cctggagatg       900
     aacacgcgcc tccaggtcga gcaccccgtc accgagctgg tctacggcgt cgacctggtc       960
     gagcagcagt tgcgcgtcgc cgccggcgag ccgctggcgc tgacgcagga cgagctgcgg      1020
     ccgcggggtc acgcggtcga ggcgcgcctc tacgccgagg atcccgccgc cggcttcctg      1080
     ccgtccaccg gcgtggtgcg ccgctggcgt gcgccggccg ggacgggcgt gcgcagcgac      1140
     gacgcgctcg ccgacggcgt cgcggtccag acccactacg acccgatgct ggcgaagctg      1200
     atcgcgcacg ggccggaccg cgcgaccgcg ctcgcgcggc tcgaccgcgc gctcgccgag      1260
     ctggagctgc tcggcgtcac gaccaatgcc gcgttcacgc gcggcctgct ggcgcgcgag      1320
     gacgtgcgtg cgggccagat ggacaccgga ctgttggagc gggtgctcgc gggcggggag      1380
     gagggcggcg cctcgccggc ggccggcacg gccgcgagcg gaccggcggc ggctggcgcg      1440
     gccgcgagcg gacgcgtcgc cggactcgcg ccgctcgacg acctgctgcc cgccgccgca      1500
     ctgacgctcg cgctcgctga cgccgacgcg ctcggggcgc atacgagcgt tccgctcggc      1560
     tggcggtccg acggtgccgc cggcacgtgg cggcggcgcg tcgtcccggg cggcggcgac      1620
     gcggtcgagc tgtgcgtgcg cggcgagacg gtgacggtcg gcgagcggac gtggtgcggc      1680
     cgggcgacgc gcagcggcga gcacgcggtc gaggtcgagc tggacggcgt cgcgcgccgc      1740
     tacgcgatcg cgaccggtga cggtgacggg cggctgtgga tcggccgcgc cgggcagcag      1800
     ctcgaactgg cgccggcgcg cgccggcggc gccgacctca gcgcagccgg cgactcgctc      1860
     gccgcgccga tgccgggcac gatcctgctc gtgcacgtca gcgacggcga cgcggtcaga      1920
     gaaggagacg tgctcgtggt gatggagtcg atgaagatgg agctgtcggt gacggcaccg      1980
     cacgacggga ccgtcgacgg cctgacggtg aaggccggcg accgcgtcgc gttgagagag      2040
     gtcctgctcg ctgtccatgg ggaggacgcc gcatga                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page