(data stored in ACNUC7421 zone)

EMBL: CP001854.PE235

CP001854.PE235       Location/Qualifiers
FT   CDS_pept        239093..240616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0235"
FT                   /product="Methylcrotonoyl-CoA carboxylase"
FT                   /EC_number="6.4.1.4"
FT                   /note="PFAM: carboxyl transferase; KEGG: atc:AGR_L_2706
FT                   3-methylcrotonyl-CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48671"
FT                   /db_xref="GOA:D3F5Z8"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z8"
FT                   /inference="protein motif:PRIAM:6.4.1.4"
FT                   /protein_id="ADB48671.1"
FT                   /translation="MSFRDGHLELIADLEARLERVRGGGGAKATERHVARGKLPARERV
FT                   ERLCDPGAPFLELAPLAAEEMYDGAAPGAGVVAGVGIVHGRHCMIVANDATVKGGTYFP
FT                   ITVKKHLRAQEIAAENRLPCIYLVDSGGAFLPMQDEVFPDREHFGRIFFNQANMSKRGI
FT                   PQLSAVMGSCTAGGAYVPAMSDETVIVREQGTIFLGGPPLVKAATGEEVTAEELGGGDV
FT                   HARTSGVVDHLAEDDADALQRIRDAVATLPAPQAPPWERIAARPPAHAEDPDGLLDVVP
FT                   LDTRTPYDVRDALRRIVDGGELHEFKALYGTTLVCAFAHVDGHPVGIVANNGVLFSESS
FT                   LKGAHFVELCDRRGIPLLFVQNVAGFMVGRDYEAGGIAKDGAKLVTAVSCARVPKLTVI
FT                   AGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAGAVMTEVGQPEVGAQLREQYE
FT                   HQGRPIYATARLWDDGVIDPRQTRNVLAAALAACANAPLEPVGYGVFRM"
     atgagcttcc gcgacggaca tctggagctg atcgccgacc tcgaggcacg gctggagcgg        60
     gtgcgcgggg gcggcggcgc gaaggcgacc gagcgccacg tcgcgcgcgg caagctgccc       120
     gctcgcgagc gggtcgagcg gctgtgcgac cccggcgcgc cgttcctgga gctggcgccg       180
     ctcgccgccg aggagatgta cgacggcgcg gcccctggcg ccggcgtcgt cgcgggcgtc       240
     gggatcgtcc acggccgcca ctgcatgatc gtcgccaacg acgcgacggt gaagggcgga       300
     acgtacttcc cgatcacggt caagaagcac ctgcgcgcac aggagatcgc ggccgagaac       360
     cggctgccgt gcatctacct cgtcgactcc ggcggcgcct tcctgccgat gcaggacgag       420
     gtcttccccg accgcgagca cttcggccgg atcttcttca accaggcgaa catgtccaag       480
     cgcggcatcc cgcagctgag cgcggtgatg ggctcgtgca ccgccggtgg cgcgtacgtc       540
     cccgcgatga gcgacgagac ggtgatcgtc cgcgagcagg ggacgatctt cctcggcggc       600
     ccgccgctgg tgaaggcggc gaccggcgag gaggtcacgg ccgaggagct gggcggcggc       660
     gacgtgcacg cgcgcacctc cggcgtcgtc gaccacctcg ccgaggacga cgcagacgcg       720
     ctgcagcgga tccgcgacgc cgtcgcgacg ctgcctgcgc cgcaggcgcc cccgtgggag       780
     cggatcgcag cgcgcccgcc cgcccacgct gaggaccctg acggcctgct cgacgtcgtc       840
     ccgctcgaca cgcgcacgcc ctacgacgtg cgcgatgcgt tgcggcggat cgtcgacggc       900
     ggcgagctgc acgagttcaa ggcgctctac ggcacgacgc tcgtctgcgc cttcgcgcac       960
     gtcgacggcc accccgtcgg gatcgtcgcc aacaacggcg tgctgttcag cgagtcgtcg      1020
     ctgaagggcg cgcacttcgt cgagctgtgc gaccgccgcg gcatcccgct gctgttcgtg      1080
     cagaacgtcg ccggcttcat ggtcggccgc gactacgagg ctggtgggat cgcgaaggac      1140
     ggcgcgaagc tcgtcaccgc ggtctcgtgt gcgcgcgtgc cgaagctgac ggtgatcgcc      1200
     ggcggctcgt tcggtgccgg caactacggc atgtgcggcc gcgcctactc gccgcgcttc      1260
     ctctggatgt ggccgaacgc gcgcatctcg gtgatgggcg gagagcaggc cggcgcggtg      1320
     atgaccgagg tcggccagcc ggaggtcggc gcgcagctgc gcgagcagta cgagcaccag      1380
     ggtcgcccga tctacgcgac cgcccgcctg tgggacgacg gcgtgatcga tccgcgccag      1440
     acccgcaacg tgctcgccgc cgcgctcgcc gcctgcgcga acgcgccgct ggagccggtc      1500
     ggctacggcg tcttccgcat gtag                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page