(data stored in ACNUC7421 zone)

EMBL: CP001854.PE236

CP001854.PE236       Location/Qualifiers
FT   CDS_pept        240671..241879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48672"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48672.1"
FT                   /translation="MRHLSAFLVIVACAVPSGLAAPAQAEEPVPALAPETVPAAVTAAV
FT                   NALALDARPCELMTRDLREHVAVVELLSHDPVVAEPWEPTDVTRLCNAYVVAGVGFGVG
FT                   IFPDRGGWVATEIGPARVVETSGDMVRLRSRVVQRFTPARDVLGSERVVDLFVVREEGV
FT                   WRLASLAGLLQLDLSNGSVPGTLAAFARERRAQTAETRRRLRAHARMVRELASVPRPLS
FT                   RTSPSCGAGGRGGVSGRADSSSNVRRFDEHSERVRGPRAARADMVAVRLRTWGGRMCWT
FT                   VRFRGDVADRIDVRFILTQPSGRDDLRAASWSLRLDGGRAAGVLEDHDGVQRMFAVRAS
FT                   VRGRVLRVVVPARRVRGQVRTGERFRWSAIDYMPDPDRPPGGTVEWVDELPQLVERGIL
FT                   HRP"
     atgcgtcatc tctccgcttt ccttgtcatc gtggcatgcg cggtcccctc cggcctcgcg        60
     gcgccggccc aggcggagga gcccgtgccg gcgctcgcgc cggagaccgt tccggcagcc       120
     gtcacagcgg ccgtcaacgc gctcgcgctc gacgcgagac cgtgcgagct gatgacgcgc       180
     gacctgcgcg agcacgtcgc cgtagtggag ctgttgtccc acgacccggt cgtggccgag       240
     ccgtgggagc cgacggacgt gacgcggctg tgcaacgcct acgtcgtcgc gggcgtcggc       300
     ttcggcgtcg gcatattccc ggatcgcggc ggctgggtcg cgacggagat cgggccggcc       360
     cgcgtggtcg agacgagcgg cgacatggtg cggttgcgtt cgcgggtggt gcaacgcttc       420
     acgcccgcgc gggacgtgct cggcagcgag cgcgtcgtcg acctgttcgt cgtgcgcgag       480
     gagggcgtct ggcggctggc gtcgctcgcc gggctgctgc agctcgacct ctccaacggc       540
     tcggtgcccg gcacgctcgc cgcgttcgcg cgagagcggc gcgcgcagac cgccgagacg       600
     cgcaggcggc tgcgcgccca cgcgcgcatg gtgcgggagt tggcctccgt cccccgcccg       660
     ctctcgcgca cgtcgccgag ctgtggtgcg ggcggccgcg gcggcgtgag cggacgcgcc       720
     gattcgtcgt cgaacgtgcg ccggttcgac gagcactccg agcgcgtgcg cggcccacgc       780
     gcggcgcgcg ccgacatggt cgccgtgcgc ttgcgcacgt ggggcggccg gatgtgctgg       840
     acggtccgct tccgcggcga tgtggcggac aggatcgacg tgcgattcat cctcacgcag       900
     ccgtcgggtc gggacgacct gcgcgccgcg agctggagct tgcgtctcga cggcggccgg       960
     gcggcaggcg tcttggagga ccatgacggc gtgcagcgca tgttcgcggt gcgcgcgtcg      1020
     gtgcgcggcc gcgtgctgcg cgtcgtcgtg ccggctcgca gggtgcgcgg ccaggtgcgg      1080
     accggcgagc ggttccgctg gtcggcgatc gactacatgc cggacccgga ccggccgccc      1140
     ggcgggacgg tcgagtgggt cgacgagctg ccgcagttgg ttgagcgcgg gattctccac      1200
     cgcccctga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page