(data stored in ACNUC7421 zone)

EMBL: CP001854.PE237

CP001854.PE237       Location/Qualifiers
FT   CDS_pept        242100..243434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0237"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bam:Bamb_4932 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48673"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D3F600"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADB48673.1"
FT                   /translation="MRWMLRAVVATVLLVAAAFTVTACGSSDDSSESASTTTGGGRGGA
FT                   KITVWHNSADPPALRQLYKDFEADTGNEVELVAIPSAGFEDTTLTKWASGARPDVLEYH
FT                   PTVTNLLALNPRNTLRDLSGEEYIAKSGDLYRSAATVDGTTYGAIIGFPQVFGMFYNKD
FT                   VFARAGIATPPGNAQELAQACTDIKARAPGVTPIAESGGSVWPPQVLPSLLMGDANQDN
FT                   AWGQELRSNRAALDDDGSPFVRAMETYRQLKDDGCFNRDLVTATVENSVRALVEGRAAM
FT                   VALHSDMIPAIVAAAGGDAARVDRAIGFLVLGGESAAATYIPGPIGSYYLPRTGDGDRE
FT                   AAALDFVRYATGRGYGRYIEASRTFPIIEGTPEPSGISALQREVKAAYDRGPANIAYAA
FT                   DVPGVAGVAALINKLMIDETTPQEMAEQTQKQIEQAAKAAKLEGW"
     atgcgctgga tgctgcgcgc ggtcgtcgcg accgtgctgc tggtcgctgc cgcgttcacg        60
     gtgacggcct gcggaagtag tgacgattca tctgagagcg cctcgaccac gacaggtggc       120
     ggcagaggcg gggcgaagat cacggtctgg cacaacagtg ccgatccgcc cgcgctgaga       180
     cagctctaca aggacttcga ggccgacacc ggcaacgagg tcgagctggt cgcgatcccg       240
     tccgcgggct tcgaggacac gacgctgacg aagtgggcgt ccggcgcccg ccccgacgtg       300
     ctcgagtacc acccgaccgt cacgaacctg ctcgcgctga acccgagaaa cacgctgcgc       360
     gatctctccg gcgaggagta catcgcgaag tccggcgacc tctacagaag cgccgcgacc       420
     gtcgacggca cgacctacgg cgcgatcatc ggcttcccgc aggtcttcgg gatgttctac       480
     aacaaggacg tcttcgccag agcgggcatc gcgacgccgc ccggcaacgc gcaggagctg       540
     gcgcaggcgt gcaccgacat caaggccaga gcgcccggcg tcacgccgat cgccgagtcc       600
     ggcggctcgg tgtggccgcc gcaggtgctg ccgtcgctgc tgatgggcga cgccaaccag       660
     gacaacgcct ggggccagga gctgcgctcc aacagagccg cgctcgacga cgacggctcg       720
     ccgttcgtga gagcgatgga gacgtacaga cagctcaagg acgacggctg cttcaacaga       780
     gacctcgtca ccgcgacggt cgagaacagc gtcagagcgc tcgtcgaggg cagagcggcg       840
     atggtcgcgc tgcactccga catgatcccg gcgatcgtgg cggcggccgg cggcgacgcc       900
     gcgagagtcg acagagcgat cggcttcctc gtactcggcg gtgagtccgc cgcggcgacg       960
     tacatccccg gtccgatcgg cagctactac ctgccgagaa ccggtgacgg cgaccgtgag      1020
     gcggcggcgc tcgacttcgt ccgctacgcg acgggcagag gctacggcag atacatcgag      1080
     gcctcgagaa ccttcccgat catcgagggc acgcccgagc cgagtgggat ctctgcgctg      1140
     cagagagagg tcaaggccgc ctacgacaga ggcccggcga acatcgccta cgcggccgac      1200
     gtccccggcg tggccggcgt cgcggcgctc atcaacaagc tgatgatcga cgagacgacg      1260
     ccgcaggaga tggccgagca gacgcagaag cagatcgagc aggcggccaa ggccgcgaag      1320
     ctcgagggct ggtag                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page