(data stored in ACNUC7421 zone)

EMBL: CP001854.PE238

CP001854.PE238       Location/Qualifiers
FT   CDS_pept        243452..244441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0238"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ara:Arad_4466 sugar ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48674"
FT                   /db_xref="GOA:D3F601"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F601"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48674.1"
FT                   /translation="MASTALTQQATGPEQETPGRPPTPPGGGRRRRGARRGGSAPLRDA
FT                   AHRKWFALPAVVLVAVFFAAPFLLNAGFAFSDWSGYSDEIGFNGIDNFRTLIDQEIFWP
FT                   AVRTTLLYALLVLTFQMAVSLPLALALTETNRANSFFRSLFFLPVLISPLAAGYIWKGL
FT                   LAPNGPINGFLTFFLPGTVDHSWLGDPQTALPAVALIEAWKWSGLITLVYIAGLKAIPK
FT                   ELLEAATIDGANAWKRFWKVKLRLLAPALTFNVAVTLAVALMAYDVIAPTTNGGPGDHT
FT                   TTLNIAMRLQWGQSFFGPASALSLTVAVLVVLTAVPLVMWLRRKELDG"
     gtggcgagca ccgcgctgac ccagcaggcg accggtccgg agcaggaaac tccgggccgg        60
     ccgccgactc ccccgggggg cggccgccgc cggcgcggcg cccgccgcgg cggctccgcg       120
     ccgctgcgcg acgcagcgca ccgcaagtgg ttcgcgctgc ccgcggtcgt actcgtcgcg       180
     gtcttcttcg ccgcgccgtt cctgctcaac gccggcttcg ccttctcgga ctggagcggc       240
     tactcggacg agatcggctt caacgggatc gacaacttcc gcacgctgat cgaccaggag       300
     atcttctggc cggccgtccg cacgacgctg ctctacgcgc tgctcgtgct gacgttccag       360
     atggcggtca gcctcccgct cgcgctcgcg ctgacggaga ccaaccgcgc caacagcttc       420
     ttccgctcgc tcttcttcct gccggtgctg atctcgccgc tggcggcggg ctacatctgg       480
     aaggggctgc tggcaccgaa cgggccgatc aacggcttcc tcaccttctt cctgccgggc       540
     accgtcgacc acagctggct cggtgacccg cagacggcgc tgccggcggt cgcgctgatc       600
     gaggcgtgga agtggagcgg gctgatcacg ctcgtctaca tcgccggcct caaggctatc       660
     ccgaaggagc tgctggaggc cgcgacgatc gacggcgcga acgcgtggaa gcgcttctgg       720
     aaggtgaagc tgcggctgct cgcgccggcg ctgacgttca acgtcgccgt cacgctcgcc       780
     gtcgcgctga tggcctacga cgtgatcgcg ccgacgacca acggcggtcc cggcgaccac       840
     acgacgacgc tcaacatcgc gatgcggctg cagtggggcc agtcgttctt cgggccggcg       900
     agcgcgctca gcctcaccgt cgcggtgctc gtcgtgctga ccgcggtccc gctcgtgatg       960
     tggctgcgac gcaaggagct ggacggatga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page