(data stored in ACNUC7421 zone)

EMBL: CP001854.PE239

CP001854.PE239       Location/Qualifiers
FT   CDS_pept        244438..245271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0239"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rlt:Rleg2_5606
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48675"
FT                   /db_xref="GOA:D3F602"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F602"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48675.1"
FT                   /translation="MTPRRATTIARYVALSLFAIPWVVLPLWMVVVNAFKTQGEAQALS
FT                   LDLPGEWAIGENFRTVIDDGNYLTGLLNSVLVTVPAIAVVLLLGSAAAWAFARTRSRWL
FT                   RAAYYLTTLSVLLPPAIIPSIYLLRELSLDGSRLGYALVTISARLGIVIFLTTGFVRAL
FT                   PGELEDAAAVDGASAFQTYRRILLPLMKPVLLVGGVILMITVWNDFFFALFLIQGEGSA
FT                   TLPLTLYGFASSTVDTLRWNLVFAHVVLTSLPLVVVYLFVQRRVLSGLTEGAVKG"
     atgacgccgc gcagagcaac gacgatcgcc cgctacgtcg cgctgtcgct gttcgcgatc        60
     ccgtgggtcg tgctgccgct gtggatggtc gtcgtcaacg ccttcaagac gcagggcgag       120
     gcgcaggcgc tgagcctcga cctcccgggc gagtgggcga tcggcgagaa cttccgcacg       180
     gtgatcgacg acggcaacta cctcaccggc ctgctcaaca gcgtgctcgt gaccgtcccc       240
     gcgatcgccg tcgtgctgct gctcggctcg gccgccgcgt gggcgttcgc ccgcacgcgg       300
     tcgcgctggc tgagagcggc gtactacctc acgacgctgt cggtgctgct gccgccggcg       360
     atcatcccgt cgatctacct gctgagagag ctgtcgctcg acggctcgcg gctcggctac       420
     gcgctcgtga cgatctcggc gcggctcggg atcgtcatct tcctcacgac cggcttcgtg       480
     cgggcgctgc ccggggagct ggaggacgcg gccgcggtcg acggcgcctc ggcgttccag       540
     acctaccgcc gcatcctgct gccgctgatg aagccggtgc tgctcgtcgg cggggtgatc       600
     ctgatgatca ccgtctggaa cgacttcttc ttcgccctct tcctgatcca gggcgagggc       660
     agcgcgacgc tgccgctgac gctctacggc ttcgcctcga gcaccgtcga cacgctgcgc       720
     tggaacctcg tcttcgcgca cgtcgtgctg acgagcctgc cgctcgtcgt ggtgtacctg       780
     ttcgtccaac gccgcgtgct gagcggcctc accgaaggag cggtcaaggg atga             834
//

If you have problems or comments...

PBIL Back to PBIL home page