(data stored in ACNUC7421 zone)

EMBL: CP001854.PE24

CP001854.PE24        Location/Qualifiers
FT   CDS_pept        complement(27728..28024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48460"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3X7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48460.1"
FT                   /translation="MSIGGLPPVDAAQLPADIRDAPPVRRDTYSAALGFEQMLVQQLTT
FT                   QMAESARSAMGGDSPYASMLPQTLADGVMDAGGLGLARQMTDAIAPAKKETTT"
     atgagcatcg gcggccttcc cccggtcgac gcggcgcagc tgccggccga catccgcgac        60
     gccccgcccg tccggcgcga cacgtacagc gccgcgctcg gcttcgagca gatgctcgtg       120
     cagcagctca cgacgcagat ggccgagtcg gccagaagcg cgatgggcgg cgactcgccg       180
     tacgcgagca tgctccccca gacgctcgcc gacggcgtga tggacgcggg cgggctcggg       240
     ctcgcgcgcc agatgaccga cgcgatcgca ccggcgaaga aggagacgac gacgtga          297
//

If you have problems or comments...

PBIL Back to PBIL home page