(data stored in ACNUC7421 zone)

EMBL: CP001854.PE240

CP001854.PE240       Location/Qualifiers
FT   CDS_pept        245268..246314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0240"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: glo:Glov_2487
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48676"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3F603"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADB48676.1"
FT                   /translation="MTTPSGDFDLVLDLIRGEVDSGRLPTAVFGVATSSGVQVLEAFGS
FT                   HGRRPLATDDTFLLFSASKPLIGLAALRLVEQGKLALRTALSEALPQFGMARIGDEVTL
FT                   WHLLTHTAGIVEATVTPDTPVREQLLTAPQMFRAGEYALYCNVAFEGIAALVESVTGRP
FT                   LHEHLPADLNALPGVEGLTFDPAAEVVPLAGLDRVLFDVERFRALRHPAGSLCARAEDL
FT                   LSLGSMLLRGDRELIHPTTLSASLTPQTTGIPRLLPDPLHIGPGTGQEWGLVWNMRMGS
FT                   PTLLEQRLYGHGGLSGCQWWMYPDHDACFVLLTGLMNPLDVGVDLDNVHNAFTTCLDPV
FT                   GASLGAAA"
     atgaccaccc cctctggcga cttcgatctc gtgctcgacc tgatccgcgg cgaggtcgac        60
     agcggccggc tgccgaccgc cgtcttcggc gtcgcgacct cctccggcgt gcaggtgctg       120
     gaggcgttcg gctcccacgg ccgccgcccg ctcgcgaccg acgacacgtt cctgctcttc       180
     tccgccagca agccgctgat agggctcgcc gcgctgcggc tggtcgagca gggcaagctg       240
     gcgctgcgga cggcgctgtc ggaggcgctg ccgcagttcg ggatggcgcg gatcggcgac       300
     gaggtgacgc tctggcacct gctgacgcac accgcgggga tcgtcgaggc gaccgtcacg       360
     ccggacacgc cggtgcgcga gcagctgctg acggcgccgc agatgttccg cgccggcgag       420
     tacgcgctct actgcaacgt cgcgttcgag gggatcgcgg cgctcgtcga gtcggtcacg       480
     ggccgaccgc tgcacgagca cctgccggcc gacctcaacg cgctgcccgg cgtcgagggg       540
     ctgacgttcg atcccgccgc ggaggtcgtc ccgctcgcgg gcctcgatcg cgtgctgttc       600
     gacgtcgagc gcttccgcgc gctgcgccac ccggccggct cgttgtgcgc cagagcggag       660
     gacctgctgt cgctcggctc gatgctgctg cgcggcgacc gcgagctgat ccacccgacg       720
     acgctgtcgg cgagcctcac gccgcagacg acgggcattc cgcggctgct gccggacccg       780
     ctccacatcg gccccggcac cggccaggag tggggcctgg tctggaacat gcggatgggc       840
     agcccgacgc tgctggagca gcggctgtac ggacacggcg gcctgtcggg ctgtcagtgg       900
     tggatgtacc cggaccacga cgcctgcttc gtcctgttga ctggtctgat gaacccgctc       960
     gacgtcggcg tcgacctcga caacgtccac aacgcgttca cgacctgcct cgacccggtc      1020
     ggcgcgtcgc tgggagccgc cgcgtga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page