(data stored in ACNUC7421 zone)

EMBL: CP001854.PE241

CP001854.PE241       Location/Qualifiers
FT   CDS_pept        246311..247948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0241"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mxa:MXAN_1573 AMP-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48677"
FT                   /db_xref="GOA:D3F604"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3F604"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADB48677.1"
FT                   /translation="MSAPSYAHGVGDVALIGETIGENLAHTAARVPERDALVSCEQGIR
FT                   WTYAQLDAAVDRLATGLLRSGVAKGDRVGLWSPNRAEWTLVQYATARIGAVLVNVNPAY
FT                   RTHELSYALRHSGTKLLFSARAFKTSDYAAMVAQVGDELQELERVVFFDDDPAWDELAA
FT                   TPADAAALAERAATLSFDDPIDIQYTSGTTGAPKGATLSHHNLLNNGFLVGELIHYSEH
FT                   DRICLPVPFYHCFGMVMGNLAATSHGACMVIPSAGFDPLATLRAVAQERCTSLYGVPTM
FT                   FIAELEHPSFAEHDLSSLRTGIMAGSPCPIEVMKQVIDKMHMREVSICYGMTETSPVST
FT                   QTRTDDPLELRVGSVGRVGPHVEVKVVEPDTGMIVKRGETGELRTRGYSVMLGYWGELE
FT                   KTAEAIDAAGWMHTGDLATMDDAGYVAIVGRIKDMVIRGGENVYPRELEELLHLHDDVV
FT                   DVQVVGVPDAKYGEELCAWVRLRDGAAVGEDDVRAFCRERVAHFKVPRHVLFVDEFPMT
FT                   VTGKVQKYKMREATIERLGLDTMEVEGR"
     gtgagcgcac cgtcctacgc gcacggcgtc ggcgacgtcg cgctgatagg cgagacgatc        60
     ggcgagaacc tcgcccacac cgccgcgcgc gtgcccgagc gcgacgcgct cgtcagctgc       120
     gagcagggga tccggtggac gtatgcgcag ctcgacgcgg ccgtcgaccg gctcgcgacg       180
     ggtctgctgc ggagcggggt cgcgaagggc gaccgcgtcg ggctgtggtc gcccaaccgc       240
     gccgagtgga cgctcgtcca gtacgcgacc gcgcggatcg gcgcggtgct ggtgaacgtc       300
     aacccggcgt accgcacgca cgagctgtcc tacgcgctgc gccactccgg cacgaagctg       360
     ctgttcagcg cgcgtgcgtt caagacgagc gactacgcgg cgatggtggc gcaggtcggc       420
     gacgagctgc aggagctgga gcgggtcgtc ttcttcgacg acgacccggc gtgggacgag       480
     ctggccgcga cgcccgcgga cgccgccgcg ctcgccgagc gcgccgcgac gctgagcttc       540
     gacgatccga tcgacatcca gtacacgagc ggcacgaccg gcgcgccgaa gggcgcgacg       600
     ctgagccacc acaacctgct caacaacggc ttcctcgtcg gcgagctgat ccactactcc       660
     gagcacgacc ggatctgcct gccggtcccc ttctaccact gcttcggcat ggtgatgggc       720
     aacctcgcgg cgacctcgca cggcgcctgc atggtgatcc cgtcggccgg cttcgacccg       780
     ctcgcgacgc tgcgcgcggt cgcgcaggag cgctgcacct cgctctacgg cgtcccgacg       840
     atgttcatcg ccgagctgga gcacccgtcg ttcgccgagc acgacctcag ctcgctgcgg       900
     accgggatca tggccggctc gccgtgcccg atcgaggtga tgaagcaggt gatcgacaag       960
     atgcacatgc gcgaggtgtc gatctgttac ggcatgaccg agacctctcc ggtctccacc      1020
     cagacgcgca ccgacgaccc gctcgagctg cgcgtcggca gcgtcgggcg ggtcggtccg      1080
     cacgtcgagg tgaaggtcgt cgagcccgac acgggcatga tcgtgaagcg cggtgagacc      1140
     ggcgagttgc gcacgcgcgg ctactccgtg atgctcggat actggggcga gctggagaag      1200
     accgccgagg cgatcgacgc ggcgggctgg atgcacaccg gcgacctcgc gacgatggac      1260
     gacgccggct acgtcgcgat cgtcgggcgg atcaaggaca tggtcatccg cggcggcgag      1320
     aacgtctacc cgcgcgagct ggaggagttg ctgcacctgc acgacgacgt cgtcgacgtc      1380
     caggtcgtcg gcgtccccga cgcgaagtac ggcgaggagc tgtgcgcgtg ggtgcggctg      1440
     cgcgacggcg ccgcggtcgg cgaggacgac gtgcgcgcct tctgccgcga gcgcgtcgcg      1500
     cacttcaagg tgccgcgcca cgtgctgttc gtggacgagt tcccgatgac ggtcaccggg      1560
     aaggtgcaga agtacaagat gcgcgaggcg acgatcgagc ggctcggcct ggacacgatg      1620
     gaggtggagg gcagatga                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page