(data stored in ACNUC7421 zone)

EMBL: CP001854.PE242

CP001854.PE242       Location/Qualifiers
FT   CDS_pept        247945..248733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0242"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; KEGG: smt:Smal_3818 DNA-binding
FT                   transcriptional regulator AgaR"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48678"
FT                   /db_xref="GOA:D3F605"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D3F605"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADB48678.1"
FT                   /translation="MTSGMYRRFVPAERRRRMAALLQRRGSVSIAELEEAFGISAMTAR
FT                   RDLAALEERGLVTRTWGGASTLAPVAHEASFADRVRRDPERKRRLADEAYKLVQPNETL
FT                   LVDSSSTGWYFVERLLEEPLPCTVITNSLAIVDLAAEVPAQVQVVVIGGILRPLTRSTV
FT                   GPAATKAIRGYYADRAIVSVYGVGTDGGLTDPDAYESEVKAAIVARAREPMLLVDASKF
FT                   GTLAQNRIGAADEFSHAIVADVGRDATDMLVGAGVELHEA"
     atgacgagcg gcatgtatcg ccggttcgtg ccggcggagc gccgcagacg gatggcggcg        60
     ctgctgcaga gacgcggctc ggtgtcgatc gcggagctgg aggaggcgtt cggcatctcc       120
     gcgatgacgg cgcggcgcga cctcgcggcg ctggaggagc gcgggctggt gacgcgcacc       180
     tggggcggcg cgagcaccct cgcgccggtc gcccacgagg cgtcgttcgc cgaccgcgtg       240
     cggcgtgacc cggagcgcaa gcgccgcctc gccgacgagg cgtacaagct cgtgcagccg       300
     aacgagacgc tgctcgtcga ctcctcctcg accggctggt acttcgtcga gcggctgctg       360
     gaggagccgc tcccgtgcac ggtcatcacg aactcgctcg cgatcgtcga cctcgccgcc       420
     gaggtgccgg cgcaggtgca ggtcgtcgtg atcggcggga tcctgcggcc gttgacgcgc       480
     tcgacggtcg ggcccgcggc gacgaaggcg atccgcggct actacgccga ccgcgcgatc       540
     gtctccgtct acggcgtcgg cacggacggc gggctgacgg accccgacgc ctacgagtcg       600
     gaggtgaagg cggcgatcgt cgcccgcgcg cgcgagccga tgctgctggt cgacgcgtcg       660
     aagttcggca cgctcgcgca gaaccgcata ggcgccgccg acgagttcag ccacgcgatc       720
     gtcgccgacg tcgggcgcga cgcgaccgac atgctggtcg gggccggcgt ggagctgcac       780
     gaggcctga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page