(data stored in ACNUC7421 zone)

EMBL: CP001854.PE243

CP001854.PE243       Location/Qualifiers
FT   CDS_pept        248737..251652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0243"
FT                   /product="alpha-L-rhamnosidase"
FT                   /note="PFAM: alpha-L-rhamnosidase; alpha-L-rhamnosidase
FT                   domain protein; KEGG: alfa-L-rhamnosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48679"
FT                   /db_xref="GOA:D3F606"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:D3F606"
FT                   /inference="protein motif:PFAM:PF05592"
FT                   /protein_id="ADB48679.1"
FT                   /translation="MAAYEGNQRVGELRGERLRCERLSDPLAVEPARPRLSWIAAAAAA
FT                   PGTSGPASGAGASGAAAGEPADAAVSRGQRPTAYRVLAASSLKALSAVSERLAGGGERR
FT                   GGAHRLPAGGRDLLWDSGRVAAAETLAVEWGGAPLAPCVRVFWRVLVWDRDGRVGPPSA
FT                   IATFGAGLGDGEDAWGGAQWLGHGHPWAEHTPAGGDELDPLHNMGMTSALLRTEFALTR
FT                   PVVRATAYATARGVYRLRLNGARVGDDELAPGWTDYRRRIHYQAFDLTRRLRSGANALG
FT                   VELGEGWYAGYVGWMAKHAGGHYGARPSALVHVRVEHADGSLTLLSTDGGGWRATRGPR
FT                   VYSDLQMGERFDARLVEAGWDEPGFDDAGWEQAVVHAPPAGARLEAQPCEPARALRELA
FT                   PIALTEPRPGTWVFDLGQNLVGWARLRAAGPRGTAVTLRFGELLRPDGTLYTDNLRTAA
FT                   ARDTFVLAGRDDGTPEQFEPAFTFHGFRYVELTGLPTAPALADLTACVVHSDAPWAGEF
FT                   ACSHELLNAIARNAEWGQRGNFLSIPTDCPQRDERLGWLADTQVFAATALRNMDCTAFL
FT                   SKWLQDVRDAQADDGAFPDVAPLPPAYDVLSHGAPGWGDGGVIVPWLVWRASGERAVLA
FT                   AHYPAMVRWMEHLAALNPSHLRRDGLYNSYGDWLNVDAQTPKDLLATAYWALDARLLEQ
FT                   IARELGHEPDATRWRALHARVAAAFGAEWVAADGSLRTPTQTGYLLALHAELLPPALRA
FT                   SAAAHLAADVVARGRRLSTGFIGTGLLCPLLTEHGHAELAYDLALADTHPSWGATVRAG
FT                   ATTMWERWDGWSEDGGFASPNMNSFNHYAFGAIGEWLHRHVAGLDQHPDVPGWGHVWVR
FT                   PQLDARLTWARAAHDSPRGPVRAGWELRDGELTLDVEIPPGAVGTVFVPGGDAAALRES
FT                   GRPLADVAGVRLDGIEGDRIVVHVDSGRYVFTHQEGRDGDD"
     atggccgcat acgaggggaa ccaacgcgtg ggcgagctgc gaggagagcg gctgcgctgc        60
     gagcggctga gcgacccgct cgccgtcgag ccggcccggc cgcggctgag ctggatcgct       120
     gcggccgcgg ccgcgcctgg cacgagcggc ccggcgagcg gcgcgggcgc gagcggcgcg       180
     gccgccggcg agccggccga cgccgccgtc tcgcgcggcc agcggccgac cgcctaccgc       240
     gtgctggcgg cgtcgtcgct gaaggcgctg agcgccgtca gcgagcggct ggctggcggc       300
     ggcgagcggc gcggcggcgc ccacaggctg ccggccggcg ggcgcgacct gttgtgggac       360
     tcgggccgcg tcgccgcggc ggagacgctc gcggtcgaat ggggcggcgc gccgctcgca       420
     ccgtgcgtgc gggtcttctg gcgcgtgctc gtgtgggacc gcgacggccg cgtcgggccg       480
     ccgagcgcga tcgcgacgtt cggcgccggg ctcggtgacg gcgaggacgc gtggggcggg       540
     gcgcagtggc tcggtcacgg ccatccgtgg gcggagcaca cgccggcggg cggcgacgag       600
     ctcgacccgc tgcacaacat ggggatgacg tcggcgctgc tgcggaccga gttcgcgctc       660
     accagaccgg tggtgcgggc caccgcctac gcgaccgcgc gcggcgtcta ccgcctgcgg       720
     ctcaacggcg cgcgcgtcgg cgacgacgag ctggcgcccg gctggaccga ctaccgcaga       780
     cggatccact accaggcgtt cgacctcacg cgccggctgc gcagcggcgc caacgcgctc       840
     ggcgtcgagc tgggcgaggg ctggtacgcg ggctacgtcg gctggatggc gaagcacgcc       900
     ggcggccact acggcgcgcg tccgagcgcg ctcgtgcacg tgcgcgtcga gcacgccgac       960
     ggctcgctca cactgctctc caccgacggc ggcggctggc gcgcgacgcg cgggccgcgc      1020
     gtctactccg acctgcagat gggcgagcgc ttcgacgcgc ggctggtcga agccggctgg      1080
     gacgagcccg gcttcgacga cgccggctgg gagcaggccg tcgtgcacgc gccgccggcc      1140
     ggcgcgcggc tggaggcgca gccgtgcgag cccgcccgcg cgctgcgcga gctggcgccg      1200
     atcgcgctga ccgagccgcg gcccgggacg tgggtcttcg acctcgggca gaacctcgtc      1260
     ggctgggcgc ggctgcgcgc cgccggtccg cgcggcaccg ccgtcacgct ccgcttcggc      1320
     gagctgctgc gccccgacgg gacgctctac accgacaacc tccgcacggc cgccgcgcgc      1380
     gacacgttcg tgctcgcggg ccgcgacgac ggcacgcccg agcagttcga gccggcgttc      1440
     accttccacg gcttccgcta cgtcgagctg accgggctcc cgacggcgcc ggcgctcgcc      1500
     gacctgacgg cgtgcgtggt ccactccgac gcgccgtggg ccggcgagtt cgcctgctcg      1560
     cacgagctgc tgaacgcgat cgcacgcaac gccgagtggg ggcagcgcgg aaacttcctg      1620
     tcgatcccga ccgactgccc gcagcgcgac gagcggctcg gctggctcgc cgacacgcag      1680
     gtgttcgccg cgaccgcgct gcggaacatg gactgcacgg cgttcctgtc gaagtggctc      1740
     caggacgtgc gcgacgctca ggccgacgac ggcgcgttcc cggacgtcgc gccgttgccg      1800
     cctgcctacg acgtgctctc gcacggcgcg cccggctggg gcgacggagg cgtgatcgtc      1860
     ccgtggctcg tctggcgcgc gtcgggcgag cgcgcggtgc tcgccgcgca ctacccggcg      1920
     atggtccgct ggatggagca cctcgccgcg ctcaacccct cgcacctgcg ccgcgacggc      1980
     ctctacaaca gctacggcga ctggctcaac gtcgatgcgc agacgccgaa ggacctgctc      2040
     gcgacggcct actgggcgct cgacgcgcgc ctgctggagc agatcgcgcg cgagctggga      2100
     cacgagcccg acgcgacccg ctggcgggcg ctgcacgccc gcgtcgcggc ggcgttcgga      2160
     gccgaatggg tcgccgccga tggcagcctg cgcacgccga cgcagaccgg ctacctgctc      2220
     gcgctgcacg ccgagctgct gccgccggcg cttcgcgcgt ccgccgctgc tcacctcgcc      2280
     gcggacgtgg tcgcgcgcgg ccggcggctc tcgaccggct tcatcggcac cggactgctg      2340
     tgcccgctgc tgaccgagca cggccacgcc gagctggcgt acgacctcgc gctcgcggac      2400
     acccacccgt cgtggggcgc gaccgtgcgc gccggcgcga cgacgatgtg ggagcgctgg      2460
     gacggctgga gcgaggacgg cggcttcgcc tcgccgaaca tgaactcgtt caaccactac      2520
     gccttcggag cgatcggcga gtggctgcac cggcacgtcg ccgggctcga ccagcacccc      2580
     gacgtccccg gctggggcca tgtctgggtc cgcccgcagc tcgatgcgcg gctgacctgg      2640
     gcgcgcgccg cgcacgactc gccgcgcggt ccggtgcgcg ccgggtggga gctgcgcgac      2700
     ggcgagctga cgctcgacgt cgagatcccg ccgggcgccg tcggcaccgt cttcgtcccg      2760
     ggcggcgacg ccgccgcgct gcgcgagtcg ggccgcccgc tcgccgacgt cgccggcgtg      2820
     cggctcgacg ggatcgaagg cgaccggatc gtcgtccacg tcgactccgg ccgctacgtc      2880
     ttcacacacc aggagggtcg cgatggcgac gattga                                2916
//

If you have problems or comments...

PBIL Back to PBIL home page