(data stored in ACNUC7421 zone)

EMBL: CP001854.PE244

CP001854.PE244       Location/Qualifiers
FT   CDS_pept        251639..252745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0244"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: noc:Noc_0279
FT                   ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48680"
FT                   /db_xref="GOA:D3F607"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F607"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB48680.1"
FT                   /translation="MATIELHGVTKRYPDGTEAVRAIDLDVADGEFLILVGPSGCGKTT
FT                   ALRMIAGLESITDGELRIDGERVNERAPKDRDIAMVFQSYALYPHMSVRDNMGFALQLA
FT                   KTPKAEVAARVEEAARVLDLTGHLDRKPGQLSGGQRQRVAMGRAIVRQPKAFLMDEPLS
FT                   NLDAKLRVQMRAELARLQHRLGTTTVYVTHDQVEAMTLGDRVAVMRDGVIQQLDTPAAL
FT                   YERPANLFVAGFIGAPGMNVVEASVADGVLRLPFGDVALPGDGDVPAGDVVAGIRPEQF
FT                   EAAALARGADPGHPRFRIVPDLVESVGSDLYAYFDLDGRQLVARLDVESRARVGEAVEL
FT                   VLDPSRIQLFNPADGRNLAVTPLTTAAR"
     atggcgacga ttgagctgca cggcgtcacg aagcgctacc ccgacggcac cgaggcggtc        60
     cgcgcgatcg acctcgacgt cgccgacggc gagttcctga tcctcgtcgg cccgtcgggc       120
     tgcggcaaga cgacggcgct gcggatgatc gcgggactgg agtcgatcac cgacggcgag       180
     ctgcggatcg acggcgagcg cgtcaacgag cgcgcaccga aggaccgcga catcgcgatg       240
     gtcttccaga gctacgcgct ctacccgcac atgagcgtgc gcgacaacat gggcttcgcg       300
     ctccagctcg cgaagacgcc gaaggcggag gtcgccgcgc gcgtggagga ggccgcgcgc       360
     gtgctcgacc tgaccggcca cctcgaccgc aagcccggcc agctgtccgg cggccagcgc       420
     cagcgggtcg cgatgggccg cgcgatcgtc cgccagccga aggcgttcct gatggacgag       480
     ccgctctcca acctcgacgc caagctgcgc gtccagatgc gcgccgagct ggcccgcctc       540
     cagcaccggc tcgggacgac gacggtctac gtcacgcacg accaggtcga ggcgatgacg       600
     ctcggcgacc gcgtcgccgt gatgcgcgac ggcgtgatcc agcagctcga cacgcccgcc       660
     gcgctgtacg agcgcccggc gaacctgttc gtcgccggct tcatcggcgc cccggggatg       720
     aacgtggtgg aggcgagcgt cgcggacggg gtgctgcggc tgccgttcgg cgacgtcgcg       780
     ctccccggcg acggtgacgt ccctgccggc gacgtcgtcg ccgggatccg tcccgagcag       840
     ttcgaggcgg cggcgctcgc gcgcggtgcc gatcccggcc acccgcgctt ccggatcgtg       900
     ccggacctcg tcgagtcggt cggctccgac ctctacgcct acttcgacct cgacggcaga       960
     cagctcgtcg cccgcctcga cgtcgagagc cgtgcgcgtg tcggcgaggc ggtcgagctg      1020
     gtgctcgacc cctcgcgaat ccagctcttc aacccagcag acggtcgcaa tctcgcagtg      1080
     acgccgctca cgaccgcggc gcggtag                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page