(data stored in ACNUC7421 zone)

EMBL: CP001854.PE245

CP001854.PE245       Location/Qualifiers
FT   CDS_pept        252799..254385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I2523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48681"
FT                   /db_xref="UniProtKB/TrEMBL:D3F608"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48681.1"
FT                   /translation="MGRMRRMGLPLLALAAGLALPSSALADEIACPARVDASAFATEAK
FT                   LLQLAERQQSFGVRPTGSQSQKDYIDWLEAEMSAIPGIRTSSLNYDIDRYESVTTGLTA
FT                   GGASVPVAAPVPFARSTGAAGVTAPVVYLASGTNITAANAAGKIVVRDLPTLSVPNALF
FT                   FPPLLGWAVHDPGLTIPLLGSESLEAPAQSNADIAAASAAGAVGVLMVSQLPHAQVEGM
FT                   YAPYEGLPQALPAAYLGVDQGQQLKDALAARTLASATLTVDARWTPTTTRTLLATLPGG
FT                   EAKKIVVESHTDGTSALWDNGPLSMIEMARYLATLPVECRPRTIQFAFTTGHLYQHLTG
FT                   PDVREGGAGQLAAILDREYDEGKVAGVLVVEHLGARQYDAVARPGGLPGRQLVVNRSLS
FT                   QLLWLPVTDGWPLRDMVKAAIQDRDVRRTAMLTGLDGADVTRVPHHCSFGGEGTPYVQH
FT                   LLPTIAAIAAPKTLFLASFGTEAIDFGLMRRGTLAFTDMVMRMGTMSQADIAGDMTFMR
FT                   EQRARGARGCS"
     atgggacgca tgcgtcgcat gggcttgccc ctgctcgcac tcgcggccgg tctcgcgctg        60
     cccagctccg cgctggcaga tgagatcgcc tgccccgctc gcgtcgacgc gagcgcgttc       120
     gccaccgagg cgaagctgct ccagctcgcg gagagacagc agtcgttcgg cgtgcggccg       180
     accggcagcc agtcgcagaa ggactacatc gactggctcg aagccgagat gagcgccatc       240
     cccggcatca gaacgtcgtc gctgaactac gacatcgacc gctacgagag cgtcacgacc       300
     ggcctcaccg ccggtggcgc gagcgtgccg gtcgccgcac cggtgccgtt cgcgagatcg       360
     accggcgccg ccggcgtgac cgcgccggtc gtctacctcg cgtccggcac caacatcacg       420
     gccgcgaacg cggcgggcaa gatcgtcgtg cgcgacctgc cgacgctgtc ggtcccgaac       480
     gcgctcttct tcccgccgct gctcggctgg gcggtccacg accccggcct gacgatcccg       540
     ctgctcggct ccgagtcgct ggaggcgccg gcgcagtcga acgccgacat cgccgccgcc       600
     agcgccgcgg gcgcggtcgg cgtgctgatg gtgagccagc tgccgcacgc gcaggtcgag       660
     gggatgtacg ccccgtacga ggggctgccg caggcgctcc ccgccgccta cctcggcgtc       720
     gaccaggggc agcagctcaa ggacgcgctc gcagcgagaa cgctcgcgag cgcgacgctc       780
     acggtcgacg cgagatggac gcccacgacg acccgcacgc tgctggcgac gctgcccggc       840
     ggcgaggcga agaagatcgt cgtcgagtcg cacaccgacg gcacgagcgc gctgtgggac       900
     aacggcccgc tgtcgatgat cgagatggcg cgctatctcg cgacgctgcc ggtcgagtgt       960
     cgcccgcgaa ccatccagtt cgcgttcacg accggtcacc tctaccagca cctgaccgga      1020
     cccgacgtgc gcgaaggcgg tgccgggcag ctcgcggcga tcctcgacag agagtacgac      1080
     gagggcaagg tcgccggcgt gctcgtcgtc gagcacctcg gcgcgcgcca gtacgacgcg      1140
     gttgcgcggc cgggcgggct gcccggcaga cagctcgtcg tcaacagatc gctcagccag      1200
     ctgctgtggc tgccggtcac cgacggctgg ccgttgaggg acatggtcaa ggccgcgatc      1260
     caggaccggg acgtgcgccg cacggcgatg ctgaccgggc tcgacggcgc cgacgtgacg      1320
     cgcgtgccgc accactgcag cttcggcggc gagggcacgc cgtacgtgca gcacctgctg      1380
     ccgacgatcg ccgcgatcgc cgcgccgaag acgctgttcc tcgcgagctt cgggaccgag      1440
     gcgatcgact tcggcctgat gcgcagaggc acgctcgcgt tcaccgacat ggtgatgaga      1500
     atgggcacga tgtcgcaggc ggacatcgcc ggcgacatga cgttcatgcg cgagcagcgt      1560
     gcgagagggg cgagaggatg ctcctga                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page