(data stored in ACNUC7421 zone)

EMBL: CP001854.PE246

CP001854.PE246       Location/Qualifiers
FT   CDS_pept        254376..256328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48682"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D3F609"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48682.1"
FT                   /translation="MLLSTYVAGAAAAALALGVGAVGAATATAADPPPFIPIERQTIPL
FT                   PEGYAASTPIWTQDGGTAGEAGGHLLFSSGGQLHTIGEDGRGLQCISCGLSNDPRIVPA
FT                   AQEAFKDVFPDGRRVMWGDFERAFVLECSPSVLQCDDRALLPVDVSGERGTGLPGLFDP
FT                   LVLGSGVWHLAPDGEHIGWTASRLDTRPMLVARLERRTDRYVATNIKTVNPPGPRNGLD
FT                   SDPRGWTNGGALYELKGFADGGASVTYVTSQYEGNPDLYKTNLATGEMTRLTGHPDWDE
FT                   DSGDSPDGELTMLHSDRGMHRVDAAGLLPRRSFVDYPISVNAAIYYVGHEEGFQCDLQP
FT                   WLLPASGDGAGRLLGQPLAPYEGGDLHPQNNVPGRGAWNPTSTKVALTEMSYTTGLGPN
FT                   RLLVAKLKRAATRPQPVVSSAVGAWARRPGDYKGTIDSNALLVTVHGLHSGRAFLSHAG
FT                   TIVAGTFSVTYDRYSDDGETFVSGTERIVAPALAQAPAVNTADLVLTGTRTGYMRANYT
FT                   IGRLLGRPVASGGVDAMLDGYRLSGDIPRLGACPDKLPRTAPLELSASVAPGAGGTRVV
FT                   TAQVHADSDPDGYAAGSFGDRRPVAGAVVTVAGQQVDTDQDGRATVVVPAGPSGPLEVG
FT                   ASAGDTFTPTRVEVS"
     atgctcctga gcacgtacgt cgcgggagcc gctgcggcgg cgctcgcgct cggcgtcggc        60
     gccgtcggcg ccgcgaccgc gaccgccgcc gacccgccgc cgttcatccc gatcgagcgg       120
     cagacgatcc cgctgcctga gggctacgcc gcgtcgacgc cgatctggac gcaggacggg       180
     ggcaccgccg gcgaagccgg tggtcacctg ctgttctcct ccggcggcca gctgcacacg       240
     atcggcgagg acggcagagg gctgcagtgc atctcgtgcg gcctgtcgaa cgacccgaga       300
     atcgtgcctg ccgcgcagga ggcgttcaag gacgtcttcc cggacggcag acgcgtgatg       360
     tggggcgact tcgagcgcgc cttcgtgctc gagtgctcgc cgagcgtgct gcagtgcgac       420
     gaccgcgcgc tgctgccggt cgacgtcagc ggcgagagag ggaccggcct gcccggcctg       480
     ttcgacccgc tcgtgctcgg ctccggcgtc tggcacctcg cgcccgacgg cgagcacatc       540
     ggctggaccg ccagccggct cgacacgcgg ccgatgctcg tcgcgagact ggagcgcaga       600
     acggacagat acgtcgcgac gaacatcaag acggtcaacc cgcccgggcc gagaaacggc       660
     ctcgactccg acccccgcgg ctggaccaac ggcggcgcgc tgtacgagct gaagggcttc       720
     gccgacggcg gcgcgtcggt cacctacgtg acgagccagt acgagggcaa ccccgacctc       780
     tacaagacga acctcgcgac cggcgagatg acgcggctga ccggccatcc cgactgggac       840
     gaggactccg gcgactcgcc cgacggcgag ctgacgatgc tccacagcga ccgcgggatg       900
     caccgcgtcg acgcggcagg cctgctgccg cgccgctcgt tcgtcgacta cccgatctcc       960
     gtcaacgcgg cgatctacta cgtcggccac gaggagggct tccagtgcga cctgcagccg      1020
     tggctgctgc cggcgagcgg tgacggcgcg ggcagactgc tcggccagcc actggcgccg      1080
     tacgagggcg gcgacctgca tccgcagaac aacgtcccgg gccgcggtgc gtggaacccg      1140
     accagcacga aggtcgcgct gacggagatg tcgtacacga ccgggctggg gccgaaccgg      1200
     ctgctggtcg cgaagctcaa gcgtgccgcg acgagaccgc agccggtcgt ctcctccgcg      1260
     gtcggcgcgt gggcgagaag accgggcgac tacaagggca cgatcgactc caacgcgctg      1320
     ctcgtgaccg tccacgggct gcactccggg cgtgcgttcc tgtcgcacgc cgggacgatc      1380
     gtcgccggca cgttctcggt cacctacgac agatactccg acgacggcga gacattcgtc      1440
     agcggcacgg agagaatcgt cgcgcccgcg ctcgcgcagg cgcccgccgt caacaccgcc      1500
     gacctcgtcc tgacgggcac gagaaccggc tacatgagag cgaactacac gatcggccgc      1560
     ctgctcggga gaccggtcgc gagcggcggc gtcgacgcga tgctcgacgg ctacagactg      1620
     tcgggcgaca tcccgagact cggtgcctgc cccgacaagc tgccgagaac ggcgccgctg      1680
     gagctgagcg catcggtcgc gccgggcgcg ggcgggacgc gtgtcgtgac cgctcaggtg      1740
     cacgccgaca gcgatcccga cggctacgcg gccggcagct tcggcgaccg ccggccggtc      1800
     gccggcgcgg tcgtgaccgt cgccggacag caggtcgaca ccgatcagga cggcagagcg      1860
     accgtcgtcg tgccggccgg gccgagcggt ccgctggagg tcggcgcgag cgccggcgac      1920
     acgttcacgc cgacgagagt cgaggtcagc tga                                   1953
//

If you have problems or comments...

PBIL Back to PBIL home page