(data stored in ACNUC7421 zone)

EMBL: CP001854.PE247

CP001854.PE247       Location/Qualifiers
FT   CDS_pept        256328..257188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_4204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48683"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F610"
FT                   /inference="similar to AA sequence:KEGG:Pmen_4204"
FT                   /protein_id="ADB48683.1"
FT                   /translation="MSRIRTLCAVVAALCCTLLVGAASASASPIEARYAASGPWAVSSA
FT                   TVRDASGRALYELRYPTDLGAGGVRHPIVTWGNGSIATPADYPGLLNHLASWGFAVVAS
FT                   TSSTTGKGTEMLAGAQYMVARDSDPASVFAGKLDTAHVAAVGHSQGAGGAVNATNLSRG
FT                   LIGTTVTYALPAAMWVSRGDEFDVAALRAPALFLGGRWDILISSPLVVDGYYRAAGGPA
FT                   AKAVLRDADHNTIQRTGGATLGYLTAWLKYRLEGDATARGAFAGSAPEINANPAWQDGA
FT                   QRALP"
     atgtcccgca tccgcacgct gtgcgccgtg gtcgcggcgc tctgctgcac cctgctcgtc        60
     ggcgccgcgt ccgcgtccgc gtcgccgatc gaggcgagat acgcggcgag cgggccgtgg       120
     gccgtcagca gcgcgaccgt cagagacgcg tcgggcagag cgctctacga gctgcgctac       180
     ccgaccgacc tcggtgcggg tggcgtccgc cacccgatcg tgacgtgggg caacggctcg       240
     atcgcgaccc cggccgacta cccggggctg ctgaaccacc tcgcctcgtg gggcttcgcg       300
     gtcgtcgcct cgaccagctc gacgacgggc aagggcacgg agatgctcgc cggcgcgcag       360
     tacatggtgg cgcgtgacag cgacccggcg agcgtcttcg cggggaagct cgacaccgcc       420
     cacgtcgcgg cggtcggcca ctcgcaggga gcgggcggcg cggtcaacgc gaccaacctg       480
     tcgagagggc tgatcgggac gacggtcacg tacgcgctgc ccgcggcgat gtgggtcagc       540
     agaggcgacg agttcgacgt cgccgcgctg agagcgcccg cgctgttcct cggcgggcgc       600
     tgggacatcc tgatctccag cccgctcgtc gtcgacggct actacagagc ggccggcggc       660
     ccggccgcga aggcggtcct gcgcgacgcc gaccacaaca cgatccagag aaccggcggc       720
     gccacgctcg gctacctgac ggcttggctg aagtaccgcc tcgagggcga cgcgaccgct       780
     cgcggcgcgt tcgccggctc cgcgccggag atcaacgcca atccggcctg gcaggacggc       840
     gctcagcgcg ccctgccgta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page