(data stored in ACNUC7421 zone)

EMBL: CP001854.PE248

CP001854.PE248       Location/Qualifiers
FT   CDS_pept        complement(257201..257974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: COL5A2; collagen, type V, alpha 2; K06236
FT                   collagen, type I/II/III/V/XI, alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48684"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:D3F611"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48684.1"
FT                   /translation="MKRLVAAALVAVLALACSVTAAQAGTTANKRTCAAKTKGRNTASR
FT                   RAACRAQRRKPARRGARGKQGRPGRAGRPGSQGAQGPAGAQGPAGPQGPAGPKGDRGEP
FT                   GPPQPGATRYAVVRDATSTPSTAFVPLGGPSLTITAPASGTIQVAASVEIADDDGLVSL
FT                   YEDGRPIAGQGDCAGLAAPGTLFTAYVTNPGGLSGPWGTPGTISSFGCATLGPPGPVTF
FT                   QTRPGEHMYELFYASCGCTTDPTFSNRKLWVTPMP"
     gtgaaacgac tcgtcgcagc agcgctggtc gccgtgctcg cgctggcgtg cagcgtcacg        60
     gcagcacagg ctggcacgac cgccaacaag agaacgtgcg ctgccaagac gaagggcaga       120
     aacaccgcgt ccagacgcgc ggcgtgcaga gcccagagaa gaaagccggc caggcgcggc       180
     gcacgcggca agcagggcag acccggtaga gctggcagac ccggctcgca gggcgcgcag       240
     ggtcccgctg gagcgcaggg accagccggc ccgcaaggtc ccgccggccc gaagggcgac       300
     cgcggggagc ccggcccgcc gcagcccggc gcgacgagat acgccgtcgt gagagacgcc       360
     acttcgaccc cctcgacagc gttcgtcccg ctcggtggac cgtcgctgac gatcaccgcg       420
     ccggcatccg gcacgatcca ggtcgccgca tcggtcgaga tcgcggacga tgacgggctc       480
     gtctcgctgt acgaggacgg cagaccgatc gcgggtcagg gcgactgcgc cggccttgca       540
     gcccccggca cactgttcac cgcgtatgtg acgaatcctg gtgggctcag cggcccctgg       600
     ggcacacctg ggacgatcag ttccttcggc tgcgcgacgc tcgggccacc cggtcccgtc       660
     accttccaga cgagaccggg cgagcacatg tatgagctgt tttatgcgtc ctgtggctgc       720
     accaccgacc cgacgttttc caatcgcaag ctctgggtca ccccgatgcc gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page