(data stored in ACNUC7421 zone)

EMBL: CP001854.PE249

CP001854.PE249       Location/Qualifiers
FT   CDS_pept        complement(258054..258788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0249"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; NodS family
FT                   protein; Methionine biosynthesis MetW protein;
FT                   Methyltransferase type 12; KEGG: rlt:Rleg2_0699
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48685"
FT                   /db_xref="GOA:D3F612"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3F612"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB48685.1"
FT                   /translation="MASSSDPTHDTVAADAAYDAMAAEYAAEGEENAYNALYERPATIA
FT                   LLPPVAGRDVLDAGCGSGPLSAWLVAHGARVTGFDTSPRMVELARARGLPGAAFSVGDL
FT                   GAPLTQFADDSFDAIVASLVLHYLHDWVAPLRELRRVLRPGGALVCSTHHPASDVELST
FT                   TGDYFATELLHDRWEKGGTTFDVRFWRRPLSAMLASIAEAGWRVDRLEEPQPLPACRER
FT                   DPEAWARLTTKPAFLFFRLVPA"
     atggcctcct cctccgatcc cacccacgac accgtcgccg ccgacgccgc ctacgacgcg        60
     atggccgccg agtacgctgc cgagggcgaa gagaacgcat acaacgcgct gtacgaacgg       120
     ccggcgacga tcgccctgct gccgccggtc gccggccgcg acgtgctcga cgccggctgc       180
     ggctcgggtc cgctctcggc ctggctcgtc gcgcacggcg cgcgcgtcac cggcttcgac       240
     acgagcccgc ggatggtcga gctggcgcgc gcccgcgggc tgcccggcgc cgcgttctcg       300
     gtcggcgacc tcggcgcgcc gctgacccag ttcgccgacg acagcttcga cgcgatcgtc       360
     gcgagcctcg tgctccacta cctgcacgac tgggtcgcgc cgctgcgcga gctgcgccgc       420
     gtgctgcggc ccggcggcgc gctcgtctgc tcgacccacc acccggcgag cgacgtcgag       480
     ctgtcgacga cgggggacta cttcgcgacg gagctgctgc acgaccgctg ggagaagggc       540
     gggacgacgt tcgacgtgcg cttctggcgc cggccgctgt cggcgatgct cgcgtcgatc       600
     gcagaagccg gctggcgcgt cgaccggctg gaggagccgc agccgctgcc ggcctgccgt       660
     gagcgcgacc cggaggcgtg ggcgagactc acgaccaagc cggcgttcct gttcttccgg       720
     ctcgttcccg cctga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page