(data stored in ACNUC7421 zone)

EMBL: CP001854.PE25

CP001854.PE25        Location/Qualifiers
FT   CDS_pept        complement(28024..28761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0025"
FT                   /product="flagellar hook-basal body protein"
FT                   /note="TIGRFAM: fagellar hook-basal body protein; PFAM:
FT                   protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein; KEGG: geo:Geob_0628
FT                   flagellar basal-body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48461"
FT                   /db_xref="GOA:D3F3X8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3X8"
FT                   /inference="protein motif:TFAM:TIGR03506"
FT                   /protein_id="ADB48461.1"
FT                   /translation="MLQGLYSAAAGMAAQQQRIDGVSNDLANISTPGYKGVRVGFRDLL
FT                   YNSQGDQAGETVTAGAGSAASFIGRSQQQGAVLTTDQPLDVSIEGSGFFQLRRADGGIA
FT                   LTRDGSFRLDPLGRVTSSDGLLLSPPVTVPRNTPIDRIAIGADGTVRVNDGQQIGRIQL
FT                   VTVTSPDGLRALGDNRFAVTPESGAATATNGATLRQGTLEGSNVDMSDAMVDMMNAQRA
FT                   FQLASRAIHMQDQMLEVANQVKR"
     atgctccaag gcctctattc ggcggccgcc ggcatggcag cgcagcagca gcggatcgac        60
     ggcgtgtcga acgacctcgc caacatctcg acgcccggct acaagggcgt ccgcgtcggg       120
     ttccgcgacc tgctctacaa ctcgcagggc gaccaggccg gcgagacggt caccgccggc       180
     gccggctcgg ccgcgtcgtt catcggccgc tcccagcagc agggcgcggt gctgacgact       240
     gaccagccgc tcgacgtctc gatcgagggc tccggcttct tccagctgcg cagagccgac       300
     ggcgggatcg cgctgacgcg cgacggcagc ttccggctcg acccgctcgg ccgcgtcacg       360
     agcagcgacg gcctgctgct gtcgccgccg gtcaccgtcc cgcgcaacac gccgatcgac       420
     agaatcgcga tcggcgccga cggcaccgtg cgcgtcaacg acgggcagca gatcggccgc       480
     atccagcttg tcacggtgac ctcgcccgac ggcctgcgcg cgctcggcga caaccgcttc       540
     gcggtcacgc cggagagcgg cgccgccacg gcgaccaacg gcgcgacgct gcgccagggc       600
     acgctcgagg gctccaacgt cgacatgtcc gacgcgatgg tcgacatgat gaacgcgcag       660
     cgcgccttcc agctcgcgag cagagcgatc cacatgcagg accagatgct cgaagtcgcc       720
     aaccaggtga agcgctga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page