(data stored in ACNUC7421 zone)

EMBL: CP001854.PE250

CP001854.PE250       Location/Qualifiers
FT   CDS_pept        258916..259377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0250"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   Polyketide cyclase/dehydrase; KEGG: pfl:PFL_4114 Aha1
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48686"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D3F613"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADB48686.1"
FT                   /translation="MVSDQIEREVLIDAPVERVWSLVTEAEHVGRWFGDAGAEIDLRPG
FT                   GAMVMRWSEHGTSHGRVEAVEPPHRFAYRWAPFSHPLGDEPVEGNSTLVEFTLTADGDG
FT                   TLLKVRETGFADLALTAPEQTAAHEGNTRGWRMELDDLVAYAKQQSAVR"
     atggtttccg accagatcga acgcgaagtc ctgatcgacg cgcccgtcga gcgcgtgtgg        60
     tcgctcgtga ccgaggccga gcacgtcggc cgctggttcg gcgacgccgg cgctgagatc       120
     gacctgcggc ccggcggcgc gatggtcatg cgctggagcg agcacggcac ctcccacggc       180
     cgcgtcgagg cggtcgagcc gccgcatcgc ttcgcctacc gctgggcgcc gttcagccac       240
     ccgctcggcg acgagccggt cgagggcaac tcgacgctcg tcgagttcac gctcacggcg       300
     gacggcgacg gcacgctgct gaaggtccgc gagaccggct tcgcggacct cgcgctgacc       360
     gcgccggagc agacggcggc gcacgagggc aacacgcgcg gctggcggat ggagctggac       420
     gacctcgtcg cgtacgccaa gcagcagtcg gcggtgcgat ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page