(data stored in ACNUC7421 zone)

EMBL: CP001854.PE251

CP001854.PE251       Location/Qualifiers
FT   CDS_pept        259374..259736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0251"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: bac:BamMC406_3818 ArsR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48687"
FT                   /db_xref="GOA:D3F614"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3F614"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADB48687.1"
FT                   /translation="MIAPAADPAPVVFAALADPTRWNLLGTLAEQGEGTATTLAAQLPV
FT                   SRPAVIKHLVVLDRAGLVERRRHGREVRYTVRPERLDATARRMAEVAAAWDKRLAAIKR
FT                   LAEAAEGAASEDATSS"
     atgatcgcgc cggccgccga ccccgcgccg gtcgtcttcg ccgcgctcgc cgacccgacc        60
     cgctggaacc tgctcggcac gctcgccgag cagggggagg ggaccgcgac gacgctcgcc       120
     gcgcagctgc cggtcagtcg cccggcggtg atcaagcacc tcgtcgtgct cgacagagcg       180
     ggcctcgtcg agcgccgacg gcatggacgc gaggtgcgct acacggtgcg tccggagcgg       240
     ctcgacgcga ccgcgcgccg gatggccgag gtcgcggcgg catgggacaa gcgcctggcc       300
     gcgatcaagc gcctggccga ggcggcggag ggagccgcca gcgaggacgc gaccagttcg       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page